KEGG   Pectobacterium atrosepticum 21A: GZ59_00980Help
Entry
GZ59_00980        CDS       T03293                                 

Gene name
sodA
Definition
(GenBank) manganese superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
pato  Pectobacterium atrosepticum 21A
Brite
Enzymes [BR:pato01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     GZ59_00980 (sodA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: AIK12015
LinkDB All DBs
Position
complement(112641..113267)
Genome map
AA seq 208 aa AA seqDB search
MSYSLPSLPYAYDALEPHFDKETMEIHHSKHHQAYVNNANAALESLPELAKLSVEELIAQ
LDKVPAEKKAALRNNAGGHANHSLFWKGLKLDTTLTGDLKAAIERDFGSVDAFKEKFEQA
AATRFGSGWAWLVLKDDGKLAVVSTANQDSPLMGEAISGTSGYPIVGLDVWEHAYYLKFQ
NRRPDYAKAFWNVLNWDEASARFASAKK
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atgagttattcactgccatcgctgccttatgcttatgacgcactggaaccgcatttcgac
aaagaaacgatggaaattcaccattccaaacaccatcaggcttacgtcaataatgctaat
gccgcgctggaatctctgcctgaactggctaaattgtctgttgaagagctgattgctcaa
ctggataaagttcctgctgagaaaaaagcagccctgcgtaacaacgctggtggccacgct
aaccacagcctgttctggaaaggcctgaaattagatactacgctgactggcgatctgaaa
gcagcaatcgaacgcgatttcggcagcgttgatgcgtttaaagaaaaatttgagcaagca
gcagcaacccgtttcggttctggctgggcttggctggttctgaaagacgacggcaaactg
gctgtagtctctactgcaaaccaagacagcccgctgatgggtgaagcaatttctggtacc
tctggctacccaatcgtcggtctggacgtatgggagcacgcttactacctgaaattccaa
aaccgtcgcccagattatgctaaagcattctggaacgtgctgaactgggacgaagcctca
gctcgcttcgctagcgcgaaaaaataa

DBGET integrated database retrieval system