KEGG   Pectobacterium atrosepticum 21A: GZ59_09390
Entry
GZ59_09390        CDS       T03293                                 

Definition
(GenBank) putative exported protein
Organism
pato  Pectobacterium atrosepticum 21A
SSDB
Motif
Pfam: SLT DUF3404 Glucosaminidase
Other DBs
NCBI-ProteinID: AIK12804
LinkDB
Position
1007994..1008602
AA seq 202 aa
MARCGILMLIIFSIFSASVSASRQSVPDGYQRVAYLHQVPPELFYAQSLQESSRKLPHGV
RPWPWSINVQGRSYQYDSRLEAWQALQRFLKTVPHKNIDVGLGQVNWGWNGRRFANSWEA
FEPYTNLNVSAQILRECYERKPDSWLRAVGCYHHPAGGAPAARYISAVQHKLAMIESSTA
ASPLPEIAHATQLVWIEPRSVK
NT seq 609 nt   +upstreamnt  +downstreamnt
atggcgcgttgcggcattctgatgctgattatattcagtattttctctgccagtgttagt
gcgtcacgacagtcagtgcctgacgggtatcagcgtgttgcgtatttacatcaggttccg
cctgagctgttctatgcacaatcattacaggagtctagccgcaagctgcctcatggcgtt
cgtccctggccctggagcattaatgtccaggggaggagctatcaatatgacagccgactg
gaagcctggcaggcactacaacgttttttgaagacggttccacataaaaatattgatgtc
ggattagggcaggttaactggggttggaacggtcgtcgttttgcaaactcctgggaggcg
tttgaaccctataccaatctgaatgtttcggctcaaatcctacgtgaatgctacgagaga
aagccggacagttggttgcgtgcggttggttgttaccaccatccggccggtggtgcccca
gcggcaagatacatttctgcggtacagcacaagctagccatgattgaatcttcgacagca
gcttccccccttcctgagattgctcatgctactcaacttgtctggatcgaaccccggagc
gtcaaataa

DBGET integrated database retrieval system