KEGG   Pectobacterium atrosepticum 21A: GZ59_09590
Entry
GZ59_09590        CDS       T03293                                 

Definition
(GenBank) putative exported protein
Organism
pato  Pectobacterium atrosepticum 21A
SSDB
Motif
Pfam: DUF1525
Other DBs
NCBI-ProteinID: AIK12824
UniProt: M4GX79
LinkDB
Position
1023323..1023727
AA seq 134 aa
MCSKIAVFLFLLSPAPLLANPVVYTDQQHPPTNLTPETQIVWLDAPERLQRSVFGEFPAS
MEQATVQAQVVMRSPKWQQHENDLQTAYRGVVHAWEIGVRKYPAVVFDDRDVVYGTADVA
MAIAYKMQEGGSHE
NT seq 405 nt   +upstreamnt  +downstreamnt
atgtgcagcaaaatagccgtttttctttttttactctcacctgcgccattactggccaat
cccgttgtttataccgaccagcaacatcctcctaccaatcttacccccgagactcagata
gtctggctggatgctccggaacggttgcagcgttccgtgtttggcgagtttcccgcatcg
atggaacaagcgacagtacaagctcaggttgttatgcgctccccgaagtggcaacagcat
gagaatgacctgcaaacggcctatcgtggtgtggtgcatgcatgggaaattggcgtgcgc
aaatatcctgctgttgtttttgacgatcgcgacgtggtgtacggtactgctgatgttgcc
atggctatcgcatataaaatgcaagaagggggtagccatgagtaa

DBGET integrated database retrieval system