KEGG   Pectobacterium atrosepticum 21A: GZ59_15310Help
Entry
GZ59_15310        CDS       T03293                                 

Gene name
afuB
Definition
(GenBank) ferric ABC transporter permease protein
  KO
K02011  iron(III) transport system permease protein
Organism
pato  Pectobacterium atrosepticum 21A
Pathway
pato02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:pato00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    GZ59_15310 (afuB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pato02000]
    GZ59_15310 (afuB)
Transporters [BR:pato02000]
 ABC transporters, prokaryotic type
  Mineral and organic ion transporters
   Iron(III) transporter
    GZ59_15310 (afuB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1
Motif
Other DBs
NCBI-ProteinID: AIK13363
LinkDB All DBs
Position
complement(1715599..1717677)
Genome map
AA seq 692 aa AA seqDB search
MSHTLTLSPTPKRDPVFLWLALIAATFLLLPAWSLDYGLLDASRDELLAAYSWSNLNISL
LWFLLPLGLLARPLLTPSREQRGRHRFDAAYALFCALFVVISATIEGRGMGYGTLGLFVA
LSAIITLALSRLDWLGGDRFVIGSLISIIALISVFILYPSIAIFIPMFTNDSGEFAPLSF
MQILSQAHILRVIWNSFLLSVAVGIGCTFFGMVLAIYTSRIARRSAIIGRIFSILPIVTP
PFVVGLGVTLMMGRSGYITELMVTWFGLTNTNWLYGFTGIWLAQVLAFTPMSFMILEGAM
KTIHPSLEEASYTLRANRYQTFQRVFLPLLKPALANSFLIVIVQSLADFSNPLVLGGNFD
VLATQIYFYITGAQLDYQSASTLGVVLLLFSLAVFCVQYLWIGKRSYVTISGKSSRGDVQ
PLPVSLVWIVSILLYVWIAFNVLLYGSIFYGSFTVNWGVDYTLTLANFSKLFGQGFSEGA
WPSLLDTLLFAGIAAPITALFGLLIAYIVVRQQFYGKKAIEFTTMLCFAVPGTVAGVSYI
LAFNSAPVYLTGTAVIVIMSMVMRNVPVGIRAGIAGLGQLDKSLDEASLSLRAGSMRTVF
YILLPLLRPAILSALIYSFVRAITTVSAIIFLVTPDTRVATSYILNRVEDGEYGMAIAYG
SILIVVMLAIIFLFDYLVGEARVSRTKAKNNA
NT seq 2079 nt NT seq  +upstreamnt  +downstreamnt
atgtcacacacactaactctctcaccgacgcctaaacgggatcccgttttcctgtggctg
gcgctgattgcagcgacatttttgctgctgccagcgtggagcctggattatggcctgctc
gatgcctcacgcgatgaactgctggcggcctacagctggtcgaacctgaatatcagcctg
ctttggtttctgctcccgttaggattactggcgcgtccactgcttacgcccagccgggaa
cagcgtggtcgccaccgttttgatgcggcttatgcgttgttctgcgccctctttgtagtc
attagtgcgaccattgaaggccgtggcatgggctatggcacccttgggctatttgttgcg
ctgagtgcgattattacgctggcgctctcgcggcttgactggctgggtggcgatcgcttc
gtcatcggctcgctcatcagcatcattgcgctgattagcgtgtttattctttaccccagc
atcgctatcttcattccgatgttcaccaacgacagtggtgaattcgcgccgctgtcgttt
atgcagattctaagtcaggcccacattttacgggtgatctggaattcattcctgctgtcg
gttgccgtcggtatcggctgtaccttcttcggtatggtgctggcgatttatacctcgcgt
attgcacgacgttccgcaattatcggccgcattttctccatcctgcctatcgttacacca
ccgtttgtcgtcgggttaggcgtgacgctgatgatgggccgttccggttatatcaccgag
ctgatggtgacttggtttggtctgacgaacaccaactggctgtatggttttaccggtatc
tggctggcgcaggtgctcgccttcacaccgatgtcgtttatgattctcgaaggcgcgatg
aagacgattcatccgtcgctggaagaagcatcgtatacgctgcgagccaaccgctatcaa
acctttcagcgagtgttcctgcccttgctaaaaccggcgctggctaactcgttcttgatc
gtgatcgtccagtcgctggccgatttcagtaacccgctggtgctgggcggcaacttcgac
gtactcgctacccagatttacttctacatcaccggggcacagttggattaccagtcggcc
agtacgctcggtgttgtcctgctgctgttctcactggccgtgttctgcgtgcaatatctg
tggatcggtaaacgctcctacgtcacgatttccggcaaatcctcccggggtgatgtgcag
ccgctgccggtttcgctggtgtggatcgtcagcatcctgctttatgtctggattgccttt
aacgttctgctgtacggcagcattttctacggcagctttaccgttaactggggcgtggat
tacaccctgacgctggcaaacttcagcaagctgttcggacaaggctttagcgaaggcgcc
tggccttccttactggatacgctgctgttcgcgggcatcgccgcaccgattacggcactg
tttgggctactgatcgcctacatcgtggtccgtcagcagttctacggcaagaaggctatc
gagttcactaccatgctgtgctttgcggtgccgggcaccgttgctggtgtgtcttatatc
ctggcctttaacagcgcgccggtttacttaacgggaaccgcggtgatcgtcatcatgtcg
atggtcatgcgtaacgtgccggtcggtattcgcgccggtatcgctgggctggggcagttg
gataaatcactggacgaggcgtcgctcagcctgagggcgggttcgatgcgcacggtgttt
tatattctgctaccgctgctacgtccggccattctgtccgcactgatttacagcttcgtg
cgtgctattaccaccgtcagcgccattatctttctggttacaccggatactcgcgtcgcc
acgtcttacattcttaaccgcgtggaagacggtgaatacggtatggcgattgcctacggc
tccatcctgattgtggtcatgctggccattattttcctgttcgattatctggtcggtgaa
gcgcgggtttcccgcacgaaagccaagaataatgcctaa

DBGET integrated database retrieval system