KEGG   Pectobacterium atrosepticum 21A: GZ59_23550Help
Entry
GZ59_23550        CDS       T03293                                 

Definition
(GenBank) copper-zinc superoxide dismutase
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
pato  Pectobacterium atrosepticum 21A
Brite
Enzymes [BR:pato01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     GZ59_23550
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-ProteinID: AIK14157
LinkDB All DBs
Position
2575295..2575819
Genome map
AA seq 174 aa AA seqDB search
MKLKALILTGVFFSCSTLAASTTVTLNEALPTGAGSSIGDVSITETPYGLLFTPNLKGLE
AGIHGFHVHENASCEPAEQDGKSVPALAAGGHFDPKKTGKHLGPYDDQGHVGDLPGLVAN
ADGTSTYPILVPRIKSLSEVKNHALMVHVGGDNYADMPAKLGGGGARMACGVIK
NT seq 525 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgaaggcacttatcctgacaggcgtgttcttttcctgttctaccttggcggca
agcaccacggttacactgaatgaagcgctgccaacgggcgcaggtagcagtatcggtgac
gtctccattacggaaacaccgtacggcctgcttttcacgccgaacttgaaaggattggaa
gcgggtattcacgggtttcacgtacatgaaaatgccagctgtgaaccagccgagcaagac
ggtaaatcggttcctgcgctggcagcaggcggccacttcgatccgaaaaaaacgggtaaa
caccttggaccttatgacgatcagggacacgtaggtgatttacccggactggtggctaat
gccgatggtacgtcaacttatccgattctagttcctcgtataaaatcactgtctgaggta
aaaaatcacgcgttgatggtacatgtcggcggggataactacgcggatatgccagcaaag
ctgggtggtggcggtgcccgcatggcgtgtggtgtgattaagtaa

DBGET integrated database retrieval system