KEGG   Pectobacterium atrosepticum 21A: GZ59_26270Help
Entry
GZ59_26270        CDS       T03293                                 

Gene name
fabI
Definition
(GenBank) enoyl-[acyl-carrier-protein] reductase [NADH]
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
pato  Pectobacterium atrosepticum 21A
Pathway
pato00061  Fatty acid biosynthesis
pato00780  Biotin metabolism
pato01100  Metabolic pathways
pato01130  Biosynthesis of antibiotics
pato01212  Fatty acid metabolism
Module
pato_M00083  Fatty acid biosynthesis, elongation
pato_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:pato00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    GZ59_26270 (fabI)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    GZ59_26270 (fabI)
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    GZ59_26270 (fabI)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:pato01004]
    GZ59_26270 (fabI)
Enzymes [BR:pato01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     GZ59_26270 (fabI)
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     GZ59_26270 (fabI)
Lipid biosynthesis proteins [BR:pato01004]
 Fatty acid synthase
  Component type
   GZ59_26270 (fabI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short Enoyl_reductase
Motif
Other DBs
NCBI-ProteinID: AIK14419
LinkDB All DBs
Position
2869516..2870304
Genome map
AA seq 262 aa AA seqDB search
MGFLTGKRILVTGVASNRSIAYGIAKAMQREGAELAFTYQNDKLKTRIEGFASELGSSIV
LPCDVAEDASIEALFTELANVWPNFDGFVHSIAYAPGDQLDGDYVDAVTREGFSISHDIS
SYSFVAMAKACRKMLNPNSALVTLSYLGAERAIPNYNVMGLAKASLEANVRYMANAMGAQ
GVRVNAISAGPIRTLAASGIKDFKKMLSHCEAVTPIRRVVTTEDVGNSAAFLCSDLAAGI
SGEVLHVDGGFSIAAMNELELK
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgggttttcttaccggtaagcgcattctggtaacaggtgttgccagcaaccgttctatt
gcctacggtattgcaaaagcaatgcaacgtgaaggtgccgaactggcgttcacgtatcag
aacgacaaattgaaaacacgcattgaaggctttgccagcgagctgggttccagcatcgtt
ctgccgtgtgatgtcgcggaagatgccagcatcgaagcactgtttaccgaactggctaac
gtatggccgaactttgatggcttcgtgcattccattgcttacgcaccgggcgaccaactg
gacggtgactacgttgatgctgttacccgtgaaggcttcagcatttctcacgacatcagc
tcttacagcttcgtcgcgatggcgaaagcctgccgtaagatgctgaacccgaactctgcg
ctggttaccctgtcctatctgggtgctgagcgtgccatccctaactacaacgtgatgggt
ctggcaaaagcctctctggaagcgaacgtacgttacatggcaaatgctatgggtgctcag
ggcgtgcgcgtcaacgccatctctgctggcccgatccgtacactggctgcatctggcatc
aaagacttcaagaaaatgttgtctcattgtgaagccgttacgccaatccgccgtgtcgtt
accactgaagacgtaggcaactctgctgcgttcctgtgttccgatctggccgccggtatc
tccggtgaagtcctgcacgttgacggcggcttcagcatcgccgcgatgaacgagctggaa
ctgaaataa

DBGET integrated database retrieval system