KEGG   Pectobacterium atrosepticum 21A: GZ59_41650Help
Entry
GZ59_41650        CDS       T03293                                 

Definition
(GenBank) major facilitator superfamily MFS_1
Organism
pato  Pectobacterium atrosepticum 21A
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 Sugar_tr MFS_1_like
Motif
Other DBs
NCBI-ProteinID: AIK15869
LinkDB All DBs
Position
complement(4486873..4488123)
Genome map
AA seq 416 aa AA seqDB search
MRLTGQVAFIIHFMFVVQLVAMGAMEMSGPFWPLHLESMSSGAELSIAGIAVYIGPMLGI
MLTSAFWGRMGDRLGNKAMMIRALFGLALTQLGLAWANDIWTIIALRFIQGACAGYIAPA
QAYGVAVVSPLQRTRLFAWLQVSTNVGSLLGAIVGGLILDYLNFFWINLSAAILCALCGI
TVALFLPHVTPVISAVPNENAQAKDIPRKRLWALSPIPGLLLISGLLLTSRMIPQTPFSL
YMDGFFQVDKWVIGLCYGLQATGVIVSASLWARYFENLSLSQTLSRLCVVMLACAIVTLT
AATMLNVAIFIPLYFLWGVLLGATTPVLMALISRAAGAGQQGYILGVAQSVSQFASILGI
SLGGLVLYSPGLRSLFFCVGVAYLVTFLVALMLLRRLRIQAEKHDSLSTKGNIENV
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atgcgtttgaccggacaggtcgcgttcatcatccactttatgtttgttgtacaactggtg
gcgatgggggcgatggagatgagcgggccgttttggccgctgcatctggaaagcatgtcg
tccggtgctgaactgagtatcgcggggattgccgtctacatcgggccgatgctgggtatt
atgctgaccagcgccttctggggacgaatgggcgatcggttgggcaacaaggccatgatg
atccgcgcgctgttcgggctggcgttgacccagcttgggttagcgtgggcaaatgacatc
tggacgataatcgcactgcgttttattcagggtgcctgtgcgggttatattgcgcccgcg
caggcatatggcgtcgcagtagttagtccgttacagcgcacgcggctgtttgcctggctt
caggtttccaccaacgtgggatcgctgctgggagcgattgtcggtggactgattctcgat
tatctgaacttcttctggatcaacctgagtgccgcgatcctgtgcgcgctatgtggtatt
accgtggcgctgttcttgccgcatgttacacccgtgatttctgctgttccgaacgagaac
gcgcaggcaaaagacattccccgcaagcggctttgggcgctgtcgccgattcccggcctg
ttgctgatttctggccttctgctgaccagccgcatgattccgcaaacgccgttttccctc
tacatggacggcttctttcaggtggataagtgggtgatcggcctgtgctatggcttgcag
gcgaccggcgtgatcgtctctgcgtcactatgggcgcgctattttgaaaacctctcgctg
tcgcagacgctgagccgcctgtgtgtggtcatgctggcctgcgccatcgtgacattgacc
gctgccacgatgctgaatgttgcgattttcatcccgctttatttcctgtggggtgtgctg
cttggggctaccacgccggttctgatggcgctgatttcgcgtgcagcgggtgccgggcag
cagggttatatactcggcgtggcgcaaagcgtcagccaatttgcctcgattcttggcatt
tctttgggcggattagttctctattcccccggactacgttcgctattcttctgcgttggc
gtcgcgtatctggtgaccttcctggtcgctctgatgctgctacgacgtctgcggatacag
gcggaaaaacatgactctctctcgacgaagggaaatatcgaaaatgtttaa

DBGET integrated database retrieval system