KEGG   Pectobacterium atrosepticum 21A: GZ59_41960Help
Entry
GZ59_41960        CDS       T03293                                 

Gene name
glpD
Definition
(GenBank) aerobic glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
pato  Pectobacterium atrosepticum 21A
Pathway
pato00564  Glycerophospholipid metabolism
pato01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pato00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    GZ59_41960 (glpD)
Enzymes [BR:pato01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     GZ59_41960 (glpD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C Pyr_redox_2 FAD_binding_2 NAD_binding_8 3HCDH_N FAD_binding_3 FAD_oxidored GIDA HI0933_like Lycopene_cycl
Motif
Other DBs
NCBI-ProteinID: AIK15900
LinkDB All DBs
Position
4527832..4529334
Genome map
AA seq 500 aa AA seqDB search
METKDLIVIGGGINGAGIAADAAGRGLSVLLLEAQDLACATSSASSKLIHGGLRYLEHYE
FRLVSEALSERETLLKMAPHIIFPMRFRLPHQPHLRPAWMIRIGLFMYDNIGKRVSLPAS
KGLKFGADSVLKPELKQGFEYSDCWVDDARLVVLNAQEVAKRGGEVRTRTKVTRARREQG
VWIVDAVDSLTGETFTWRAKGLVNATGPWVKEFFDDGLQLKSPYGIRLIKGSHIVVPRVH
NQPQAYILQNKDHRIVFVIPWQDDYSIIGTTDVEYKGNPHDVKIDDNEVGYLLDVYNDHF
KQQLTRDDIVWTYSGVRPLCDDESDSPQAITRDYTLSVDDDNGQAPLLSVFGGKLTTYRK
LAEHALDKLHKYYPQAGKAWTKDAVLPGGDIAGTRDDYAAALRRRFNLPESLTRRYSRTY
GSNSELILANVKGLSDLGEDFGHDLYEAELRYLVEKEWAVTLDDVIWRRTKLGMRFDDAQ
KQRISDWLVSYRQQQMAKAG
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
gtggaaaccaaagatctcatcgttatcggcggcggaattaacggtgcaggcatcgccgca
gatgcggctgggcgagggctatcagtcctgttgttggaagcgcaggatcttgcctgtgcc
acgtcctctgccagctctaagctgattcacggcggcctgcgctaccttgagcactatgag
tttcgtttggtcagcgaagcactgtctgaacgcgaaacgctgctgaaaatggctccgcac
attattttcccaatgcgctttcgtttgccccatcagccgcacctgcgtccagcctggatg
attcgtatcggcctgttcatgtatgacaacattggcaaacgcgtcagcctgcctgccagt
aagggactgaaattcggtgcagattccgttcttaagcctgagttgaagcaaggctttgaa
tattctgactgctgggtggacgatgcgcgtctagtggtgttaaacgcgcaggaagtggca
aaacgcggcggagaagtccgcacccgcaccaaagttacccgcgctcgccgtgaacaaggc
gtgtggattgtggatgccgttgactcactgaccggcgaaaccttcacctggcgtgccaaa
ggcctggtgaatgcgaccggcccgtgggtgaaagaattctttgatgacggcttacagctg
aaatcgccttacggcatccgtttgatcaaaggcagccacatcgtggtgccaagagtccat
aaccagccgcaggcgtatattctgcaaaacaaagatcaccgtattgtattcgtgatcccg
tggcaggatgactactcgatcatcggtacgaccgacgtagagtacaaaggtaatccgcac
gatgtgaagatcgatgacaacgaagtcggctacctgctggatgtgtataacgaccatttc
aaacagcaacttacgcgtgacgatatcgtctggacttactccggcgtgcgcccactgtgc
gatgacgagtccgattctccacaggcgattacccgtgattacacgctgtcggtagacgat
gacaacggtcaggctccactgctttccgtgtttggcggcaagctgacgacgtaccgtaaa
ctggcagagcacgcgctggacaagctccacaaatactatcctcaggcgggtaaagcctgg
acgaaagatgcggtactgccgggcggtgatatcgctggcacgcgtgatgactacgccgcc
gcgctgcgtcgccgcttcaatctgcctgaatcactgacgcgccgttacagccgtacctac
ggttcaaacagcgaactgattctggcaaacgtgaaaggcctcagcgatctgggtgaagat
ttcggtcatgacctgtatgaagccgaactgcgctatttggtcgagaaagaatgggcggtc
acgctggacgacgtcatctggcgccgcaccaaactgggcatgcgctttgatgacgcgcag
aaacaacgcatcagcgactggttagtcagctaccgccaacaacagatggcaaaagcgggt
taa

DBGET integrated database retrieval system