KEGG   Pectobacterium atrosepticum 21A: GZ59_44780Help
Entry
GZ59_44780        CDS       T03293                                 

Definition
(GenBank) putative zinc-binding dehydrogenase
  KO
K23007  L-galactonate 5-dehydrogenase [EC:1.1.1.414]
Organism
pato  Pectobacterium atrosepticum 21A
Pathway
pato00053  Ascorbate and aldarate metabolism
pato01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pato00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00053 Ascorbate and aldarate metabolism
    GZ59_44780
Enzymes [BR:pato01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.414  L-galactonate 5-dehydrogenase
     GZ59_44780
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 AlaDh_PNT_C 2-Hacid_dh_C 3HCDH_N Pyr_redox_2 NAD_binding_7 Sacchrp_dh_NADP HI0933_like AdoHcyase_NAD FAD_binding_3 TrkA_N Shikimate_DH Pyr_redox_3 Pyr_redox FAD_binding_2 GIDA adh_short NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: AIK16163
LinkDB All DBs
Position
4840413..4841435
Genome map
AA seq 340 aa AA seqDB search
MSTMNTLICQEPKKLVWKKREIPIPGEGEALIKIKSVGICGTDIHAWGGNQPFFSYPRVL
GHEICGEVVDTGKNVDVFKKGQQVAVIPYVACQQCPACKSGRTNCCEKISVIGVHQDGGF
SEYLAVPATNLLLAEGIDPQAAALIEPYAISAHAVRRAKVLQGEQVLVVGAGPIGLGAAA
IAKAEGAHVVVADTSAARREHVIAHLGLSVVDPSAEDFEAQLRAEFGGSLAEKVIDATGN
QHAMNNTINLIRHGGSIVFVGLFKGDLQFSDPEFHKKETTMMGSRNATPEDFAKVGRLMS
EGKLTAEMMLTHRYPFSTLADIYERDVINNRELIKGVITF
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgtcaacaatgaataccttgatttgccaggaaccgaaaaaattagtctggaaaaaacgt
gaaatacctattccgggtgagggtgaagcattaattaaaattaagtctgtgggtatttgc
ggaacagatattcatgcctggggagggaaccaaccttttttcagctatccacgcgtatta
ggtcacgaaatatgtggtgaagttgtcgataccggaaaaaatgtagatgtctttaaaaaa
ggccagcaggttgccgtcattccctatgtcgcctgtcagcaatgtccagcctgcaagagc
ggtcgtaccaactgctgcgagaaaatttcagtgataggtgtacatcaggacggcggattc
agcgagtatctggcggttcccgccacaaacttactgctcgcagaagggatcgatccacaa
gcggcagcattaatcgaaccatacgccattagtgcgcacgccgtccgtcgggcaaaggtg
ttacagggtgaacaggtgctggtcgtcggcgccggaccgattggcctcggcgcggcagcc
atcgccaaagcagagggcgctcacgtggttgtcgccgataccagcgcagcccgccgcgaa
cacgttattgcccacctgggtttatcggtagtcgatccctctgccgaggactttgaagcc
cagctacgcgccgaatttggcggttcactggcagaaaaagtgattgatgccacgggcaat
cagcatgcgatgaacaacaccattaacctgatccgccacggcggcagcatcgtgtttgtc
ggtctgtttaaaggcgatttgcagttctccgaccctgagttccacaagaaagaaactacg
atgatgggcagccgtaacgccacaccggaagacttcgccaaagtaggacgtctgatgtct
gaaggtaaactcaccgcagaaatgatgctgacgcaccgttatcccttttccacactggct
gacatctatgaaagggatgtcattaacaaccgtgagctgatcaaaggcgtcatcacattc
tga

DBGET integrated database retrieval system