KEGG   Pectobacterium atrosepticum 21A: GZ59_45900Help
Entry
GZ59_45900        CDS       T03293                                 

Definition
(GenBank) putative beta-ketoacyl-ACP synthase
  KO
K09458  3-oxoacyl-[acyl-carrier-protein] synthase II [EC:2.3.1.179]
Organism
pato  Pectobacterium atrosepticum 21A
Pathway
pato00061  Fatty acid biosynthesis
pato00780  Biotin metabolism
pato01100  Metabolic pathways
pato01212  Fatty acid metabolism
Module
pato_M00083  Fatty acid biosynthesis, elongation
pato_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:pato00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    GZ59_45900
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    GZ59_45900
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:pato01004]
    GZ59_45900
Enzymes [BR:pato01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.179  beta-ketoacyl-[acyl-carrier-protein] synthase II
     GZ59_45900
Lipid biosynthesis proteins [BR:pato01004]
 Fatty acid synthase
  Component type
   GZ59_45900
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ketoacyl-synt Ketoacyl-synt_C Thiolase_N
Motif
Other DBs
NCBI-ProteinID: AIK16273
LinkDB All DBs
Position
complement(4960574..4961800)
Genome map
AA seq 408 aa AA seqDB search
MRRVVVTGMGGVTAFGESWENVSDGLRAGHNAIRKMPEWQVYDGLNTQLGSPIDNFSLPE
HYTRKRIRSMGRVSLMATRATELALEKAGLIGHPVLTNGETGIAYGSSTGSTGPVSEFAT
MLTEKHTNNITGTTYVQMMPHTTAVNACLFFGLRGRVIPTSSACTSGSQAIGYAWEAIRH
GYQTVMVAGGAEELCPSEAAVFDTLFATSQRNDAPETTPSPFDASRDGLVIGEGAGTLVL
EELEHALARGATIYAELVGFYTNCDAAHITQPQRETMQICIEGSLRCAGLQPSDVGYISA
HGTATDRGDVAESLATAAVFGKSTPISSLKSYFGHTLGACGALEAWMSIEMMREGWFAPT
LNLRQPAEDCGELDYIMGEPRHIETDYIQSNNFAFGGINTSLIFRRWQ
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcgcgtggtggtaacgggaatgggcggggttaccgcattcggtgaatcttgggaa
aacgtctctgacggtttgcgcgcagggcacaatgctatacgtaagatgcccgaatggcag
gtttatgatggcctgaatacgcagttgggttcgccgattgataacttcagtctgccagag
cactacacgcgtaaacgcatccgctcgatggggcgcgtgtccctgatggcaactcgagcc
accgaattggcgctggaaaaggcagggttgattggtcatccggtgctgacgaatggagaa
accggcattgcttacggttcttcaacggggagcacggggccggtgagcgaattcgccacc
atgctgacagaaaagcacaccaataatattaccggtacgacctatgtgcagatgatgccg
catactacggcggtgaatgcctgtctgttttttgggctgcgcggccgtgtgattccgacg
tccagtgcctgtacatcggggagtcaggcgattggctatgcttgggaagcaatacgccat
ggctatcagacggtaatggttgctggcggtgcggaagagctgtgtccatcggaggcagcc
gtgtttgatacgctgtttgccaccagccaacgcaacgatgcgccagagactacgccgtct
ccttttgacgccagccgcgacggtttggttatcggcgaaggggctggtacgttagtgctg
gaagagcttgaacatgcattggcgcgtggggcgacgatctatgctgaactggttgggttt
tacaccaactgtgatgcggcacatatcacgcagccccagcgtgaaaccatgcagatttgt
attgaaggatcgctgcgctgtgcagggttgcagcccagtgatgtgggttatatcagcgcc
catggtacagcaaccgatcggggtgacgtcgcggagagtctggcaaccgccgctgtgttc
ggtaaatccacaccgatttcgtcgctaaaaagctatttcggtcacacgctgggtgcctgt
ggtgcgcttgaagcgtggatgagtatcgagatgatgcgtgaaggctggtttgcaccgacg
cttaatttacggcaacctgcggaagactgcggcgaattggactacatcatgggtgagcca
cgccatattgagactgattacattcagtctaataacttcgcctttggcggcatcaatacg
tcgctgattttccgccgttggcaataa

DBGET integrated database retrieval system