KEGG   Pectobacterium atrosepticum JG10-08: EV46_01080Help
Entry
EV46_01080        CDS       T03199                                 

Gene name
fadB
Definition
(GenBank) multifunctional fatty acid oxidation complex subunit alpha
  KO
K01825  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
patr  Pectobacterium atrosepticum JG10-08
Pathway
patr00071  Fatty acid degradation
patr00280  Valine, leucine and isoleucine degradation
patr00281  Geraniol degradation
patr00310  Lysine degradation
patr00362  Benzoate degradation
patr00380  Tryptophan metabolism
patr00410  beta-Alanine metabolism
patr00640  Propanoate metabolism
patr00650  Butanoate metabolism
patr00903  Limonene and pinene degradation
patr00930  Caprolactam degradation
patr01100  Metabolic pathways
patr01110  Biosynthesis of secondary metabolites
patr01120  Microbial metabolism in diverse environments
patr01130  Biosynthesis of antibiotics
patr01200  Carbon metabolism
patr01212  Fatty acid metabolism
Module
patr_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:patr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    EV46_01080 (fadB)
   00650 Butanoate metabolism
    EV46_01080 (fadB)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    EV46_01080 (fadB)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    EV46_01080 (fadB)
   00310 Lysine degradation
    EV46_01080 (fadB)
   00380 Tryptophan metabolism
    EV46_01080 (fadB)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    EV46_01080 (fadB)
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    EV46_01080 (fadB)
   00281 Geraniol degradation
    EV46_01080 (fadB)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    EV46_01080 (fadB)
   00930 Caprolactam degradation
    EV46_01080 (fadB)
Enzymes [BR:patr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     EV46_01080 (fadB)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     EV46_01080 (fadB)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     EV46_01080 (fadB)
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  Delta3-Delta2-enoyl-CoA isomerase
     EV46_01080 (fadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2
Motif
Other DBs
NCBI-ProteinID: AIA69228
LinkDB All DBs
Position
complement(239795..241984)
Genome map
AA seq 729 aa AA seqDB search
MLYQGESLYLNWLEDGIAELVFSAPGSVNTLDTRTVASLGKALDVLAEQPNLKGLLLRSD
KAAFIVGADITEFLSLFAAPAEKLHEWLVFANSIFNRLEDLPVPTLSAINSYALGGGCEC
VLATDFRLATPDARIGLPETKLGIMPGFGGTVRLPRLLGADSALEIIAAGKDVSAADALK
VGLVQAVVANEKLIPAAIKMLKQAINGELDWLGYRRPKLEALKLNKIEAMMSFTTAKAMV
LQTAGKHYPAPMLAVKTIEAAATMTRDEALQLETQHFVQLARSNEARALVGIFLNGQYVK
GKAKKLIGETSVPKQAAVLGAGIMGGGIAYQSAFKGVPIRMKDINEKPLALGMNEAAKLL
NKQMERGKLDGMKMATILANIHPTLDYAGFERTDIVVEAVVENPKIKASVLAETELHVSE
NTILASNTSTIPIAVLAASLKRPQNFCGMHFFNPVHRMPLVEIIRGPKTSDSTIASVVAY
ASKMGKTPIVVNDCPGFFVNRVLFPYFAAFSILLRDGADFREIDNVMEKKFGWPMGPAYL
LDVVGIDTAHHAQAVMAEGFPQRMAKDYRDAIDVLFEHQRFGQKNGQGFYRYQTDSKGKL
RKEQDEAVDTLLKDISQPKKTFSAEEIIARMMIPMINEVARCLEEGIVASPAEADMALVY
GLGFPPFHGGACRYLDTLGSERYVEMAQQLAHLSAIYQVPDGLQQKARSNEGYYPSVAPH
ADVSHGQPA
NT seq 2190 nt NT seq  +upstreamnt  +downstreamnt
atgctttatcaaggtgaatccctctaccttaactggcttgaggacggcattgccgagctg
gtattttctgcccctggctctgtaaacacgctagatacccgcacggttgccagcctgggt
aaggcgctggacgttctggcggaacagccgaacctgaagggcttactgctgcgatcagac
aaagctgcatttattgtcggtgccgatatcacggaattcctttctctttttgccgcgccg
gccgaaaagctgcatgagtggcttgtcttcgccaacagcattttcaaccgtcttgaggat
ttacccgttcccacgctgtccgcgattaatagctatgcgctgggaggcggatgtgaatgc
gtgctggcgaccgattttcgcttagcaacgccagatgcacgaatcgggttgcctgagact
aaactcggaatcatgccgggctttggcggcacagtcaggctaccgcgtctgttaggtgca
gacagcgcgctggagattatcgccgcaggtaaagacgtcagcgcagccgatgctttaaaa
gtggggctggtgcaggctgttgtcgctaatgaaaaactgattcccgccgccatcaagatg
ctaaagcaggccataaatggcgagctggactggctgggttaccgacgcccgaaacttgag
gcgctgaagctcaataaaattgaagccatgatgagctttaccaccgccaaagcgatggtg
ctacaaaccgctgggaaacattatccagcgccgatgttagcggtaaaaaccatcgaagcc
gccgcaaccatgacacgtgatgaggcattgcagctcgaaacgcagcacttcgttcaactg
gcgcgttcaaatgaagctcgcgccctcgtcggcattttcctcaacggtcaatatgttaaa
ggaaaagcgaagaagctgattggcgaaacatccgtaccaaagcaggccgccgtgctgggt
gcgggcattatgggcggcggaattgcctatcaatccgcgttcaaaggcgtgccaattcgg
atgaaggatatcaacgagaagccactcgcgctggggatgaacgaggcagctaagctcctg
aataaacagatggaacgaggcaaactggacggaatgaaaatggcgacgattttggcaaac
attcacccgacgctggattacgccgggttcgaacgtaccgatatcgtagttgaagccgtc
gtagagaacccgaaaatcaaagccagcgtattagcggaaaccgaattgcacgttagcgag
aatacgattctggcttctaatacctcaacgattccaattgctgtgctggctgcatcgtta
aaacgaccgcaaaatttctgcggtatgcacttcttcaacccggtacaccgcatgccgctg
gtcgaaattattcgcggccctaaaaccagtgacagtaccatcgccagcgtggtggcttac
gccagcaagatgggcaagacgccgattgttgtgaacgattgcccaggattcttcgtaaat
cgcgtcctgttcccctactttgcagcattcagcatactgctcagagacggtgccgatttc
cgcgagatcgataacgtcatggagaagaaattcggctggccgatgggtccagcctatctg
ctggacgttgtcggcattgataccgctcaccatgcccaagcggtgatggcggaaggtttt
ccacagcggatggcgaaagactatcgcgatgcgattgacgtgttgtttgagcatcagcgc
tttgggcagaaaaatggtcagggtttctaccgttatcaaacggatagcaaagggaaactg
cgcaaagaacaggatgaagccgtagatacgctccttaaagacatcagccaaccgaaaaaa
acgttcagcgcagaagagattatcgctcggatgatgatcccaatgattaatgaagttgcg
cgctgtctggaagaaggtattgtcgccagtcctgccgaagcggacatggcactggtatat
gggttaggttttcctcccttccacggcggagcctgccgctatctggatacgttgggcagc
gaacgttatgtcgagatggcgcaacagctggcgcacctcagcgccatctatcaagtgcct
gacggcttacaacaaaaagccagaagcaatgaaggctattacccatcggtcgcgccacac
gcggacgtttcccacggtcaaccggcatga

DBGET integrated database retrieval system