KEGG   Pectobacterium atrosepticum JG10-08: EV46_09385Help
Entry
EV46_09385        CDS       T03199                                 

Definition
(GenBank) xylose isomerase
  KO
K01805  xylose isomerase [EC:5.3.1.5]
Organism
patr  Pectobacterium atrosepticum JG10-08
Pathway
patr00040  Pentose and glucuronate interconversions
patr00051  Fructose and mannose metabolism
patr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:patr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    EV46_09385
   00051 Fructose and mannose metabolism
    EV46_09385
Enzymes [BR:patr01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     EV46_09385
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AP_endonuc_2
Motif
Other DBs
NCBI-ProteinID: AIA70790
LinkDB All DBs
Structure
PDB: 

Position
2137040..2138038
Genome map
AA seq 332 aa AA seqDB search
MATYNYPEFGAGLWHFANYIDRYAVDGYGPALSTIDQINAAKEVGELSYVDLPYPFTPGV
TLSEVKDALKDAGLKAIGITPEIYLQKWSRGAFTNPDPAARAAAFELMHESAGIVRELGA
NYVKVWPGQDGWDYPFQVSHKNLWKLAVDGMRDLAGANPDVKFAIEYKPREPRVKMTWDS
AARTLLGIEDIGLDNVGVLLDFGHALYGGESPADSAQLIIDRGRLFGMDVNDNLGGWDDD
LVVGTVHMTEIFEFFYVLKINNWQGVWQLDQFPFRENHVEAAQLSIRFLKHIYRALDKLD
IPALQAAQEAQNPLQAQRIVQDALLSSINVSE
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atggcaacgtataactaccctgaatttggtgccggtttgtggcattttgcgaattatatc
gaccgctacgccgtagacggctacggcccggcattgagcacgatcgatcagatcaatgcg
gcgaaagaggtcggcgagctttcctatgtcgacctgccttatcccttcacgccgggcgtc
acgctaagcgaagtgaaagatgcactgaaggatgcagggctgaaagcgattggcatcacg
ccggaaatttacctgcaaaagtggtcgcgtggcgccttcaccaaccccgatccggcggcc
cgagctgcggcgtttgaactgatgcatgaatctgctggcattgtgcgtgaattgggtgcg
aattatgtcaaagtctggccggggcaggatggctgggattatccgtttcaggtcagccat
aaaaatctgtggaagcttgccgttgatggtatgcgcgatctggcaggggctaaccccgat
gtgaaattcgccatcgaatacaagccgcgtgaaccgcgcgtgaaaatgacctgggattcc
gctgcgagaacgctgctgggtattgaagacatcgggctggataacgtcggcgtgctgctg
gacttcggacatgcactgtatggcggtgaatcacccgctgattctgcccagttgattatc
gatcgcggccggctgttcggaatggatgtaaacgacaatctgggcggctgggatgacgat
ttggtggtcggcacggtgcacatgactgagattttcgaattcttctatgtgttgaaaatc
aacaactggcagggcgtctggcagctcgatcagttcccgttccgtgagaatcacgtggag
gcggcgcagttgtccatccgtttcttgaagcacatctatcgtgcgctggacaagctggat
atccccgcgcttcaggcggcacaggaagcgcaaaatccgttacaggcacagcggattgtg
caggatgcgctgctgtcatccattaacgttagcgaataa

DBGET integrated database retrieval system