KEGG   Pectobacterium atrosepticum JG10-08: EV46_14190Help
Entry
EV46_14190        CDS       T03199                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
patr  Pectobacterium atrosepticum JG10-08
Pathway
patr00480  Glutathione metabolism
patr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:patr00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    EV46_14190
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:patr02000]
    EV46_14190
Enzymes [BR:patr01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     EV46_14190
Transporters [BR:patr02000]
 Other transporters
  Pores ion channels [TC:1]
   EV46_14190
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_2 GST_C GST_C_3 Tom37 GST_C_5 Glutaredoxin
Motif
Other DBs
NCBI-ProteinID: AIA71705
LinkDB All DBs
Position
complement(3174347..3175039)
Genome map
AA seq 230 aa AA seqDB search
MLNAQLTLISHPLCPFVQRAAIVLLEKNVSFERIDVDLAAKPDWFLALSPMGKVPLLKVE
LAGHSDAILFESAAICEYLNETQAGASLYSSDALSRAQQRAWVEFGVAALSDAWQFLNAK
ELAVANDKKAAFRDKLQRLESTLEQGPYFSGSAFSMVDAMFAPVFRYFDLLSPDVSQPIF
DNLPRVSAWRASLAHRPSVIAAVRDDYVDRFKQHLVKQQAILSDSMCKTT
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atgcttaacgctcagttgacgcttatcagccatccgttgtgcccgttcgttcagcgggcg
gcgattgtgctgctggaaaaaaacgtctcctttgaaaggatcgacgtcgatctcgcagct
aagcctgactggtttctggcgctttcgcctatgggtaaggtgccattgctcaaggtggaa
ttagcgggccattctgacgcgattctgttcgagagcgcagctatttgcgaatatctcaac
gaaacgcaggcaggagccagcctttattccagtgatgcactttcccgtgcacagcaacgt
gcctgggtagagtttggcgtggcggctctctccgatgcctggcagttcctgaatgctaag
gagctcgccgttgctaacgataagaaagctgcctttcgcgataagttgcagcgacttgag
agcactcttgagcaaggtccctatttttcaggctccgcgttcagtatggtcgatgcgatg
tttgccccggtctttcgctactttgacttgctaagccccgacgtttcgcagccgattttc
gacaatcttccccgtgtatcggcgtggcgggcttcactggcacacaggccaagcgtcatt
gctgccgtgcgagacgattacgtcgacagatttaagcagcaccttgttaagcagcaggca
atactctcagactcaatgtgtaagacaacctga

DBGET integrated database retrieval system