KEGG   Pseudomonas aeruginosa UCBPP-PA14: PA14_00910
Entry
PA14_00910        CDS       T00401                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K11891  type VI secretion system protein ImpL
Organism
pau  Pseudomonas aeruginosa UCBPP-PA14
Pathway
pau02025  Biofilm formation - Pseudomonas aeruginosa
pau03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:pau00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    PA14_00910
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02025 Biofilm formation - Pseudomonas aeruginosa
    PA14_00910
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pau02044]
    PA14_00910
Secretion system [BR:pau02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   PA14_00910
SSDB
Motif
Pfam: IcmF-related_N IcmF-related IcmF_C RHH_1
Other DBs
NCBI-ProteinID: ABJ15033
UniProt: A0A0H2ZK24
LinkDB
Position
complement(89166..92474)
AA seq 1102 aa
MQSLAEVSAPDAASVATAEELATLKQRMDEALALLKRAKLGGSERRNLYELPWYVIIGPP
GSGKTTALMNSGLDFPLAAQMGAGAIRGVGGTRNCDWWFTDEAVLLDTAGRYTTQDSHAQ
VDKAAWLGFLDLLKTQRKRRPIDGAFIAISLSDLLLGSDAERAAHAQAIRARIQELYQQL
GVRFPIYVMLTKFDLVPGFMEFFDSLNREERAQVWGMTFALDDGKSAEGPLAVFDSEFAL
LEQRLTARLVERLQQERDPARRDLVYGFPQQFAALRECLGEFLNGVFKPNPYEERPLLRG
LYFTSGTQEGSPIDRLIGSMAQSMNLDRQHLARQTGTGRSYFIERLFREVAFGERGLVGT
NPKVERRRKWLTIGALSATALVVLAVTAVWIASYRANQSYIAAVDQRVDPLARGIESLSP
AQRDVLAVLPQLNAVQNLAGDAPSWAEGYGLYQGDMLGEESASVYRKLLIAVFAPRLVTR
IEEQLRSGGSSDFLYEGLKAYLMLGSPDHYDADFIKAWISLDWERNLPRDLSPEQRQALH
AHLDALLERRPPSARLDQDLVEDLRRQLQQLPVAQRVYDRVKRQRLPKDVPDFRISDAAG
RDAPLVFARKSGKPLTDPLSGFFTYRGYREVFLTASLSQAGTIAEEQWVLGRDLNDAGDA
ANLALDVRRLYFQDYLRQWDDLLADLTVVPITNVTQAADVLRILSGPTSPFRKLLEAVAR
ETDLQKGDRLVAAQVKKAADGTVDKLKQRLGSLVGQEEEEGAREQPQQADSDPISAHFAE
LNSLVSKGEGGNEPAPIDSLLEDMNALYVQVSAMAGASGDSLLGDAKNQVAAAASRVALS
AERQPPVVQGLVKNVVNSTTSSMMGSVRNQLNAAWISDVVSVYRQSLAGRYPIAAGSSRD
ATLEDFGHFFGAGGVMDSYFRQYLQPYVDTSASTWRWQPGAAQKLGINPGVLHTFQRAAA
IRDAFFRSGGMQPAVRFELKPVTMDAAISQFILDLDGQQLTYDHGPARPVAMQWPSANGL
GVVRLTVTPPPSSGRSGLTLEGPWAWFRLLDQSDLERGNSPDRFTLRLRIDGSSIACELR
ASSAFNPFKSRVVSGFSLPERL
NT seq 3309 nt   +upstreamnt  +downstreamnt
atgcagagtctcgccgaggtcagcgcgccggacgccgccagcgtcgccaccgccgaagag
ctggcgaccctcaagcaacgcatggacgaggccctggccctgctcaagcgggccaagctg
ggcggcagcgagcggcgcaacctgtacgagttgccctggtacgtgatcatcggcccgccc
ggttcgggcaagaccaccgcgctgatgaactccggcctggacttcccgctcgccgcacag
atgggcgccggggcgatccgcggggtcggcggcacgcgcaactgcgactggtggttcacc
gacgaagcggtgctgctggacaccgccggccgctataccacccaggacagccacgcccag
gtggacaaggccgcctggctgggcttcctcgacctgctcaagacccagcgcaagcgccgc
cccatcgatggcgcgttcatcgccatcagcctttccgacctgctgctgggcagcgacgcc
gagcgcgccgcccatgcccaggcgatccgcgcgcgcatccaggagctgtaccagcagctc
ggggtgcgcttcccgatctacgtgatgctgaccaagttcgacctggtgccgggcttcatg
gagttcttcgacagcctgaaccgcgaggaacgcgcgcaggtctgggggatgaccttcgcc
ctcgacgacggcaagagcgcggaaggcccgctggcggtgttcgacagcgaattcgccctg
ctcgaacagcgtctcaccgcgcgcctggtggaacgcctgcagcaggagcgcgacccggcg
cggcgcgacctggtctacggcttcccgcagcaattcgccgccctgcgcgaatgcctcggc
gagttcctcaacggcgtgttcaagcccaacccctacgaggaacgcccgctgttgcgcggc
ctgtacttcaccagcggaacccaggaaggcagtccgatcgaccgcctgatcggcagcatg
gcgcagtcgatgaacctcgaccgccagcacctggcgcggcagaccggaaccgggcgcagc
tacttcatcgagcggctgttccgcgaagtggcgttcggcgaacgcggcctggtcggcacc
aacccgaaggtcgagcgccgccgcaaatggctgaccatcggcgcgctgagcgccaccgcg
ctggtggtgctggcggtgacggcggtatggatcgccagctaccgcgccaaccagagctac
atcgccgcggtcgaccagcgcgtcgacccgctggcgcgcggcatcgagtcgctgagcccg
gcccagcgcgacgtcctggccgtactgccacagctcaacgcggtgcagaatctcgccggc
gacgcgccaagctgggccgaaggctacgggctgtaccagggcgacatgctcggcgaggag
tccgccagcgtctaccgcaagctgctgatcgcggtgttcgccccgcgcctggtgacccgc
atcgaggaacagttgcgctccggcggcagcagcgatttcctctacgagggcctgaaggcc
tacctgatgctcggcagcccggaccattacgacgccgacttcatcaaggcctggatcagc
ctcgactgggaacgcaacctgccgcgcgacctctcgccggaacagcgccaggcgctgcac
gcgcacctcgacgcgttgctcgaacgacggccgccgtcggcgcgcctggaccaggacctg
gtcgaggacctgcgccgccagttgcagcaactaccggtggcgcagcgggtctacgaccgg
gtcaagcggcagaggctgcccaaggacgtgcccgacttccgcatcagcgacgccgccggc
cgcgacgcaccgctggtgttcgcgcgcaagagcggcaagccgctcaccgacccgctcagc
ggcttcttcacctaccgcggctatcgcgaggtgttcctcaccgccagcctcagccaggcc
ggcaccatcgccgaggaacagtgggtgctcgggcgcgacctgaacgatgccggcgatgcc
gccaacctggccctcgacgtgcgtcgcctgtacttccaggactacctgcggcaatgggac
gacctgctcgccgacctcaccgtggtgccgatcaccaacgtcacccaggccgccgacgtg
ctgcgcattctctccgggccgacctcgccgttccgcaagctgctcgaggcggtggcccgc
gagaccgacctgcagaagggcgaccggctggtcgccgcgcaagtgaagaaggccgccgac
ggcaccgtggacaagctcaagcagcgcctcggctcgctggtcggccaggaggaggaggaa
ggcgcccgcgaacagccgcagcaggccgacagcgacccgatcagcgcccacttcgccgaa
ctcaacagcctggtcagcaagggcgagggcggcaacgagccggcgccgatcgacagcctg
ctggaggacatgaacgcgctctacgtacaggtcagcgccatggccggagccagcggcgac
tcgctgctcggcgacgccaagaaccaggtggccgccgccgcctcgcgcgtggccctcagc
gccgagcgccagccgccggtggtccagggcctggtgaagaacgtggtcaactccaccacc
agcagcatgatgggcagcgtgcgcaaccagctcaacgcggcctggatcagcgacgtggtc
agcgtctaccggcagtccctggccgggcgctacccgatcgccgccggcagctcgcgcgac
gccaccctggaagacttcggccacttcttcggtgccggtggggtgatggacagctacttc
cgccagtacctgcaaccctacgtcgacacctccgccagcacctggcgctggcagcccggc
gcggcgcagaagctcggcatcaaccccggcgtgctgcacaccttccagcgcgcggcggcg
atccgcgacgccttcttccgctccggcggcatgcagccggcggtgcgcttcgaactcaag
ccggtgaccatggacgcggcgatcagccagttcatcctcgacctcgacggccagcagctg
acctacgaccacggccccgcccgcccggtggcgatgcagtggccgagcgccaacggcctc
ggcgtggtccgcctgacggtgacgccgccgcccagcagcggccgttccggcctgaccctg
gagggcccctgggcctggttccgcctgctcgaccagtcggacctggaacgcggcaactcg
ccggaccgcttcaccctgcggctgcgcatcgacggctccagcatcgcctgcgagctgcgc
gccagcagcgccttcaaccccttcaagagccgggtcgtgtccggcttcagcctcccggag
cgcctttga

DBGET integrated database retrieval system