KEGG   Pseudomonas aeruginosa UCBPP-PA14: PA14_09600Help
Entry
PA14_09600        CDS       T00401                                 

Gene name
ddlA
Definition
(GenBank) D-alanine-D-alanine ligase A
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
pau  Pseudomonas aeruginosa UCBPP-PA14
Pathway
pau00473  D-Alanine metabolism
pau00550  Peptidoglycan biosynthesis
pau01100  Metabolic pathways
pau01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:pau00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    PA14_09600 (ddlA)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    PA14_09600 (ddlA)
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    PA14_09600 (ddlA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:pau01011]
    PA14_09600 (ddlA)
Enzymes [BR:pau01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     PA14_09600 (ddlA)
Peptidoglycan biosynthesis and degradation proteins [BR:pau01011]
 Precursor biosynthesis
  Amino acid ligase
   PA14_09600 (ddlA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp ATP-grasp_4 ATPgrasp_YheCD GARS_A ATPgrasp_ST ATPgrasp_Ter
Motif
Other DBs
NCBI-ProteinID: ABJ13474
UniProt: A0A0H2ZG97
LinkDB All DBs
Position
824984..826024
Genome map
AA seq 346 aa AA seqDB search
MGQDKLKVAVLFGGSSEERDVSIASGAQVIQALRSAGHQVLAVDTASGLLGAEEERRLLA
SKVKEVPPDSDSLAIIRSGKQSLLSAGELAGVDVFFLALHGGTGEDGTLQALLDAGGFAY
TGSGHLASAMAMDKDVAKRLFLAAGVETASWLMAPASEEAVREQLGFPLVVKPNSQGSTV
GLSIVHSQAELQPAIELAGRYGDEVMLERFVAGREVTVGVLDDQALPVGEILLGGQEVFD
YEHKYQAGAVREVFPADLPPAIAAEAQRLALKVHRALKLSGYSRTDFRLDEQGRLWCLEV
NTLPGMTATSLLPQAAAAAGIGFAELCERICRLGIERCKGARKARS
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgggacaggacaagttgaaggtcgccgttctcttcggcggcagcagtgaggaacgggac
gtctccatcgccagcggcgcgcaggtgatccaggcgttgcgcagcgccggccaccaggtg
ctggcggtggataccgccagcggcctgctcggcgcggaggaagagcgccgcctgctggcg
agcaaggtcaaggaggtcccgccggactccgactcgctggcgatcatccgcagcggcaag
cagagcctgctgagcgccggcgaactggctggggtcgacgtgttcttcctcgccctgcac
ggcggcaccggcgaggacggcaccctgcaggcgctgctggatgccggcggtttcgcctat
accggcagcggccacctggccagcgccatggcgatggacaaggacgtggccaagcgcctg
ttcctcgccgccggggtggagaccgccagttggctgatggcgccggcctcggaagaggcg
gtgcgcgagcaactgggcttccccctggtggtcaagccgaacagccagggctccaccgtg
gggctgtccatcgtgcattcccaggccgaattgcagccggctatcgagctggccgggcgc
tatggcgacgaggtgatgctggagcgcttcgtcgccggccgcgaggtcaccgtcggggtg
ctcgacgaccaggcgctgccggtgggcgagattctcctcggcggccaggaggtcttcgac
tacgagcacaagtaccaggccggcgcggtgcgcgaggtgtttcccgccgacctgccgccg
gcgatcgccgccgaggcccagcgtctggcgctgaaggtacaccgggcgctgaagctgagc
ggctacagccgcaccgacttccgcctcgacgaacagggccggctctggtgcctggaggtc
aataccctgccgggcatgaccgccaccagcctgctgccgcaggccgcggcggcggccggg
atcggtttcgccgaactctgcgagcggatctgccggctcggcatcgagcgctgcaagggc
gcgcgcaaggcgcgttcctga

DBGET integrated database retrieval system