KEGG   Pseudomonas aeruginosa UCBPP-PA14: PA14_10870Help
Entry
PA14_10870        CDS       T00401                                 

Definition
(GenBank) putative porin
  KO
K07267  porin
Organism
pau  Pseudomonas aeruginosa UCBPP-PA14
Brite
KEGG Orthology (KO) [BR:pau00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pau02000]
    PA14_10870
Transporters [BR:pau02000]
 Other transporters
  Pores ion channels [TC:1]
   PA14_10870
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OprB
Motif
Other DBs
NCBI-ProteinID: ABJ13374
UniProt: A0A0H2ZFS2
LinkDB All DBs
Position
complement(940586..941890)
Genome map
AA seq 434 aa AA seqDB search
MKTLRTLPALLCAGFLGLSAQAAEDSRSGPLAGFGERLQRHGVKTHAQFWSLSLKNLDTG
PRQHSFGNSGDLFLGADLDLATLAGLDGASLHIEETLFILDRGTGQPTGPSWQGAVGSYF
GGAPLHNDIGANQLSLLTWQQQWLGGRLDSHLGRTNARRYFLIYNCETVVTCNDPIIDAS
TGILPPPYGAWGGYLKYRATPTLYLHAGAFESNPVDYLKKRHGLDFGTDDASGTSLLLGI
GDKREESLDPYRSHYELNAYLNTANQVDPLTGASDHGSAGGFFKFQQLFWRADGGRLDSP
RALGLFGSLSVSADDKQPFRHFAELGMTYHAPFDRTRDKLNLKASYLRLNDHQLEFQRQA
RIAAGGDAKLGQRDVYALETNAHIALTPHIALEPSVQYIFNPDNYYNPGARELSGDGFVV
GLQLMVDMGSLLGL
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaccctccgcaccttgccggcgctgctctgcgccggtttcctcggtctctccgcg
caggccgccgaagacagccgcagcggcccgctggccgggttcggcgaacgactccagcgc
cacggcgtgaagacccacgcgcagttctggagcctgtcgctgaagaacctcgacaccggc
ccgcgccagcacagcttcggcaacagcggcgacctgttcctcggcgccgacctcgacctc
gccaccctcgccggcctggacggcgcctcgctgcacatcgaggaaaccctgttcatcctc
gaccgcggcaccggtcagcccaccgggccgagctggcagggcgcggtgggcagctacttc
ggcggcgcgccgctgcacaacgacatcggcgccaaccagctgagcctgctcacctggcag
cagcagtggctgggcggacgcctcgacagccatctcggacgcaccaatgcgcggcgctat
ttcctgatctacaactgcgagaccgtggtcacctgcaatgacccgatcatcgacgcctcc
accggcatcctgccgccgccctacggcgcctggggcggctacctgaagtaccgggcgacc
ccgaccctgtacctgcacgccggggccttcgagtccaacccggtggattacctgaagaag
cgccatggcctcgatttcggcaccgacgacgccagcggcaccagcctgctgctggggatc
ggcgacaagcgcgaggaaagcctcgatccctatcgctcgcactatgaactcaatgcctac
ctgaacaccgccaaccaggtcgacccgctcaccggcgccagcgaccacggcagcgccggc
ggcttcttcaagttccagcagctgttctggcgcgccgacggcggccgcctcgattcgccg
agggcgctggggctgttcggctcgctgtcggtatcagccgacgacaagcagccgttccgt
catttcgccgagctgggcatgacctaccatgcacccttcgaccgcacgcgggacaagctc
aacctcaaggccagctacctgcgcctgaacgatcaccagctggagttccagcgccaggcg
cggatcgccgctggcggcgatgcgaaactcggccagcgcgacgtgtacgccctggaaacc
aatgcgcacatcgcactgaccccgcacatcgcgctggagccgtcggtgcagtacatcttc
aacccggacaactactacaaccccggcgctcgcgaactgagtggagacggtttcgtcgtc
ggcctgcaactgatggtcgacatgggctcgctgctggggctttag

DBGET integrated database retrieval system