KEGG   Pseudomonas aeruginosa UCBPP-PA14: PA14_10960Help
Entry
PA14_10960        CDS       T00401                                 

Definition
(GenBank) possible ferridoxin oxidoreductase subunit
Organism
pau  Pseudomonas aeruginosa UCBPP-PA14
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Rieske
Motif
Other DBs
NCBI-ProteinID: ABJ13367
UniProt: A0A0H2ZFZ1
LinkDB All DBs
Position
complement(947387..948499)
Genome map
AA seq 370 aa AA seqDB search
MSLPNANLIASSRKAAAQMATRDTSFIFNEWYVAAFAEEVGRELLARTLLGKRVVLYRTL
AGQAVALEDRCAHRSFPLSRSRLEGDGIVCGYHGFRYDSQGELIETPSQKACPRGVGIRH
YPLLERGPLVWIWLGDPRLADPKRLPQRPWLEDPGWACSKGYFLHPGNYVSMHENLMDLT
HLTYLHANTIGTPDYAGAPYELDLKEGHYRLVRHVLPTTLSPVWGRTTGLDGCPTAARIT
TSEFLSPGLHQVSATFYDTALPAERRPEFHIRTAHILTPETHGSMHYFIVHGRDFAQDDE
TVGAFMHEQLFAAFVEDVEGLGALEKVLAEADEDSYEISVASDAPAVATRTYLKRRADEE
AHQRAAHRVA
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgagcctgcccaacgccaatctcatcgccagttcacgcaaggccgccgcgcagatggcc
acgcgcgacacgtcgttcatcttcaacgagtggtacgtcgccgccttcgccgaggaggtc
ggccgcgaactgctcgcgcgcactctgctcggcaagcgcgtggtgctctatcgcaccctc
gccggccaggcggtagccctggaagaccgctgcgcgcatcgctccttcccgctatcgcgc
agtcgcctggagggggacgggatcgtctgcggctatcacggtttccgctacgacagccag
ggcgagttgatcgagacaccgtcgcagaaagcctgtccgcgcggcgtcggcatccgtcac
tacccgcttctggagcgcggcccgctggtctggatttggctcggcgacccgcgactggcc
gacccgaagcgactgccgcagcggccctggctggaggatccgggctgggcctgctccaag
ggctacttcctacacccgggcaactacgtgagcatgcacgagaacctgatggacctgacc
catctcacctacctccacgccaataccatcggcaccccggattacgccggggcgccctat
gagctggacctgaaggaaggccactaccggctggtacggcacgtgctgccgaccaccctg
tcgccggtctggggccgcaccaccggcctcgacggctgtcccacggcggcgcgcatcacc
acctcggagtttctctcgccaggcctgcaccaggtcagcgcgaccttctacgacacagcc
ctgcccgccgagcggcgaccggaattccacatccgcacggcgcacatcctcaccccggag
acccacggcagcatgcactacttcatcgtccacggacgcgatttcgcccaggacgacgag
accgtcggcgctttcatgcacgagcaactgttcgccgccttcgtcgaggacgtggaaggc
ctcggcgcgctggaaaaggtactcgcggaggccgatgaggatagctacgagatctccgtt
gccagcgacgcgccggcggtggccacccgcacctacctcaagcgccgcgccgatgaggaa
gcgcaccagcgcgcggcgcaccgggtggcctga

DBGET integrated database retrieval system