KEGG   Pseudomonas aeruginosa UCBPP-PA14: PA14_12060Help
Entry
PA14_12060        CDS       T00401                                 

Gene name
pbpA
Definition
(GenBank) FtsI / penicillin-binding protein 2
  KO
K05515  penicillin-binding protein 2 [EC:3.4.16.4]
Organism
pau  Pseudomonas aeruginosa UCBPP-PA14
Pathway
pau00550  Peptidoglycan biosynthesis
pau01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:pau00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    PA14_12060 (pbpA)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    PA14_12060 (pbpA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:pau01011]
    PA14_12060 (pbpA)
Enzymes [BR:pau01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     PA14_12060 (pbpA)
Peptidoglycan biosynthesis and degradation proteins [BR:pau01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   PA14_12060 (pbpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transpeptidase PBP_dimer
Motif
Other DBs
NCBI-ProteinID: ABJ13277
UniProt: A0A0H2ZEK5
LinkDB All DBs
Position
1040914..1042854
Genome map
AA seq 646 aa AA seqDB search
MPQPIHLKDHEKDARLVRRRVIVGAVAVVLLTLVLVARMYHLQVTQYEYHSTLSENNRVH
VQPIPPTRGIIFDRNGVIIADNRPSFSLTITRERTEDLQKTLDTLVEILGLTEDDRAIFE
KRMKQGRRPFEPVPIMFELNEEQIARIAVNQFRLPGVDVATQFVRHYPLKEHFAHSVGYV
GRINEQELKNLDPINYSGTHHIGKTGIERFYESELHGTVGYEEVETNARGRVLRVLKRTD
PIPGKDIVLSIDSRLQEAAENALAGRRGAIVAIQPSTGDVLAMVSQPSYDPNLFVTGISF
KAYAELRDSIDRPLYNRVLRGLYPPGSTVKPAVALAGLDAGVVTPTSRVFDPGYYQLPNY
DHKYRNWNRYGDGWVSLESAIYRSNDTYFYDLAHKLGIDRLHAFMSRFGFGQKVALDMFG
EADGLMPSREWKRKTRRQVWYPGETLILGIGQGYMQATPIQLAQMTALLANKGHWIRPHL
AKTIDGQPPVDPDPMPDIVLRDPANWDRVDYGMQQVVHGARGTARKVGATSAYLIAGKSG
TAQVVAIKQNERYDRSKLLERHRDHALFVGFAPANNPQIAVAVMVENGESGSGVAAPVVK
QVMDAWLLDEHGKLKAEYAEPVAPLAAAVAKPEPTAAEPEAPALEQ
NT seq 1941 nt NT seq  +upstreamnt  +downstreamnt
atgccgcagccgatccacctgaaagaccacgagaaagacgcccgcctggtgcgtcggcgc
gtcatcgtcggggcggtggcggtggtcttgctgaccctggtgctggtggcgcgcatgtac
cacctgcaggtgacccagtacgagtaccattcgacgctgtcggagaacaaccgggtccat
gtgcagccgatcccgccgacccgcgggatcatcttcgaccgcaacggcgtgatcatcgcc
gacaaccggccgagcttcagcctgaccatcacccgcgaacgcaccgaggacctgcagaag
accctcgacacgctggtggagatcctcggcctgaccgaggacgaccgggccatcttcgag
aagcgcatgaagcaggggcggcgtccgttcgagccggttcccatcatgttcgaactcaac
gaggaacagatcgcccgcatcgcggtgaaccagttccgcctgccgggcgtcgacgtggcg
acccagttcgtccgccactacccgctgaaggagcacttcgcccattcggtcgggtacgtc
gggcggatcaacgagcaggaactgaagaacctcgacccgatcaactacagcggcacccac
catatcggcaagaccggcatcgagcgcttctacgagagcgagctgcacggcaccgttggc
tacgaggaagtcgagaccaacgcccgcgggcgggtgctgcgggtgctcaagcgcaccgac
ccgattcccggcaaggacatcgtcctgagcatcgatagccgcctgcaggaggccgccgag
aacgccctggccgggcggcggggcgccatcgtggcgatccagccgtccaccggcgacgtg
ctggcgatggtcagccagccgagctacgaccccaacctgttcgtcaccggcatcagcttc
aaggcctatgccgagctgcgcgactccatcgaccggccgctgtacaaccgcgtcctgcgc
gggctctatccgccgggctcgacggtgaaaccggcggtggcgctggccggcctcgacgcc
ggggtggtcacgccgacctcgcgggtcttcgaccccggctactaccagttgcccaactac
gaccacaagtaccgtaactggaaccgctacggcgatggctgggtgagcctggagtcggcg
atctaccggtccaacgacacctatttctacgacctcgcgcacaagctggggatcgaccgc
ctgcacgccttcatgagtcgcttcggtttcggccagaaagtcgccctggacatgttcggc
gaagccgacgggctgatgccctcgcgcgaatggaagcgcaagacccgccgccaggtctgg
tacccgggggagaccctgatcctcggcatcggccagggctacatgcaggcgacgccgatc
cagttggcgcagatgaccgcgctgctggccaacaagggccactggatccgcccgcacctg
gccaagaccatcgacggccagccgccggtcgaccccgacccgatgcccgacatcgtgctg
cgcgacccggccaactgggaccgcgtcgactacggcatgcagcaggtggtgcatggcgcc
cgtggcacggcgcgcaaggtcggcgccacctcggcctacctgatcgccggcaagagcggt
accgcccaggtggtggcgatcaagcagaacgagcgctacgaccgctccaagctgctcgag
cggcaccgcgaccacgccctgttcgtcggcttcgcgccggccaacaacccgcagatcgcg
gtggcggtgatggtggagaacggcgagtccggctccggcgtcgccgccccggtggtcaag
caggtgatggacgcctggctgctcgacgagcacggcaagctcaaggccgaatacgcggaa
cccgtcgcgccgctcgcggcggcggtggccaagcccgaacccacggcagccgagccggag
gcgcccgcccttgaacagtaa

DBGET integrated database retrieval system