KEGG   Pseudomonas aeruginosa UCBPP-PA14: PA14_30180Help
Entry
PA14_30180        CDS       T00401                                 

Gene name
idh
Definition
(GenBank) monomeric isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
pau  Pseudomonas aeruginosa UCBPP-PA14
Pathway
pau00020  Citrate cycle (TCA cycle)
pau00480  Glutathione metabolism
pau01100  Metabolic pathways
pau01110  Biosynthesis of secondary metabolites
pau01120  Microbial metabolism in diverse environments
pau01130  Biosynthesis of antibiotics
pau01200  Carbon metabolism
pau01210  2-Oxocarboxylic acid metabolism
pau01230  Biosynthesis of amino acids
Module
pau_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pau_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:pau00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PA14_30180 (idh)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    PA14_30180 (idh)
Enzymes [BR:pau01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     PA14_30180 (idh)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IDH
Motif
Other DBs
NCBI-ProteinID: ABJ11847
UniProt: A0A0H2ZC63
LinkDB All DBs
Position
complement(2612524..2614749)
Genome map
AA seq 741 aa AA seqDB search
MSIRSKITYTFTDEAPALATYSLLPIVKAFAASAGIDVETSDISLAGRILANFADRLDAD
QRIEDDLARLAVLATSPDANIIKLPNISASVPQLKGAIAELQGLGYKVPDFPEDPQTDEE
KEVRARYAKILGSAVNPVLREGNSDRRAPAAVKAYARKHPHSMGKWSMASRSHADYMRGG
DFFSSEQSITMAKAGDVRIEFVGKDGKVEVKKQLSLQEGEVLDSMFMSCGKLRDFFEKTL
QDCKETGVMWSLHVKATMMKISHPIVFGHAVSVYYKDVFDKWGQLFEELGVNPNNGISSV
YDKIKSLPASQQEEILHDIHEVYSHRPEMAMVDSVKGITNLHIPSDVIVDASMPAMIRNS
GQMWGKDGKQKDTKAVMPESTYARIYQEMINFCKTNGAFDPTTMGSVPNVGLMAQKAEEY
GSHDKTFEMTADGTMRVVLADGSVLMQHEVETGDIWRACQTKDAPIRDWVKLAVTRARQS
DTPAIFWLDPERAHDRELRKKVELYLKDHDLTGLDISIMGYNEAIRVSMERLIRGKDTIS
VTGNVLRDYLTDLFPIMELGTSAKMLSIVPLMAGGGMYETGAGGSAPKHVQQLVEENYLR
WDSLGEFLALAVSLEETGIKTGNAKAKLLGKALDEATGKLLDNNKSPSRKVGDIDNRGSH
FYLAMYWAQALAAQDEDAELKAHFAPLAKALTEQEATIVAELNAVQGKPAEIGGYYRSNP
ELTSKVMRPSATFNAAIDSLA
NT seq 2226 nt NT seq  +upstreamnt  +downstreamnt
atgtccatccgctcgaagatcacctacaccttcaccgacgaagcacccgcgctcgccacc
tactcgctcctccccatcgtcaaggcctttgccgcttccgccggcatcgacgtcgagacc
agcgacatctctcttgcaggacgcatcctggccaacttcgccgaccgcctcgacgccgac
cagcgtatcgaagacgacctcgcccgcctggcggtcctggccacctcgcccgacgccaat
atcatcaagctgcccaacatcagcgcctcggtgccccagctgaaaggcgcaatcgccgaa
ctgcagggcctgggctacaaggttcccgacttcccggaagacccgcagaccgacgaagag
aaagaggttcgcgcacgctacgcgaagatcctcggcagcgccgtgaacccggtcctgcgc
gaaggcaactccgaccgtcgcgcgcctgccgcggtgaaggcctacgcccgcaagcacccg
cactccatgggcaagtggagcatggcctcccgctcccacgccgactacatgcgcggcggc
gacttcttctccagcgaacagtccatcaccatggccaaggccggtgacgtgcgcatcgag
ttcgtcggcaaggacggcaaggtcgaggtcaagaagcaactgagcctgcaggaaggcgaa
gtgctcgacagcatgttcatgagctgcggcaagctgcgcgacttcttcgagaagaccctg
caggactgcaaggaaaccggcgtcatgtggtccctgcacgtcaaggcgaccatgatgaag
atttcccacccgatcgtcttcgggcatgcggtgagcgtctactacaaggacgtcttcgac
aagtggggccaactcttcgaagagctcggcgtgaacccgaacaacggtatctccagcgtc
tacgacaagatcaagtcgctgcccgcctcccagcaggaagagatcctccacgacatccac
gaggtgtacagccaccgcccggaaatggcgatggtcgactccgtgaaaggcatcaccaac
ctgcacattccgagcgacgtcatcgtcgacgcctcgatgccggcgatgatccgcaactcc
ggccagatgtggggcaaggacggcaagcagaaagataccaaggcggtaatgccggaaagc
acctacgcccgcatctaccaggagatgatcaacttctgcaagaccaacggcgccttcgac
ccgaccaccatgggcagcgtgccgaacgtcggcctgatggcgcagaaggccgaggaatac
ggctcccacgacaagaccttcgaaatgaccgccgacggcaccatgcgcgtggtcctggcc
gacggcagcgtgctgatgcagcacgaggtggagacaggcgacatctggcgcgcctgccag
accaaggacgcgccgatccgcgactgggtcaagctggccgtcacccgcgcgcgccagtcc
gacaccccggcgatcttctggctggacccggagcgcgcccacgaccgcgaactgcgcaag
aaggtcgagctgtacctcaaggaccacgacctgaccggcctcgacatcagcatcatgggc
tacaacgaggccattcgcgtcagcatggaacgcctgatccgcggcaaggacaccatctcg
gtgaccggcaacgtcctgcgcgactacctgaccgacctgttcccgatcatggaactgggc
acctcggccaagatgctctccatcgttccgctgatggcgggcggcggcatgtacgaaacc
ggcgccggcggctcggcacccaagcacgtccagcaactggtggaagagaactacctgcgc
tgggactccctgggcgagttcctggccctggccgtgtccctggaggaaaccgggatcaag
accggcaacgccaaggccaagctgctcggcaaggcgctggacgaagccaccggcaagctg
ctggacaacaacaagtcgccgtcgcgcaaggtcggcgacatcgacaaccgcggcagccac
ttctacctggcgatgtactgggcccaggccctggccgcccaggacgaagacgccgagctg
aaagcgcacttcgcgccgctggccaaggccctgaccgagcaggaagcgaccatcgtcgcc
gaactcaatgcggtccagggcaagccggccgagatcggcggctactatcgctccaacccg
gagctgaccagcaaggtgatgcgccccagcgccaccttcaacgcggcgatcgacagcctg
gcctga

DBGET integrated database retrieval system