KEGG   Pseudomonas aeruginosa UCBPP-PA14: PA14_36730Help
Entry
PA14_36730        CDS       T00401                                 

Definition
(GenBank) putative trehalose synthase
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
pau  Pseudomonas aeruginosa UCBPP-PA14
Pathway
pau00500  Starch and sucrose metabolism
pau01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pau00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PA14_36730
Enzymes [BR:pau01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     PA14_36730
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     PA14_36730
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C Mak_N_cap Apolipoprotein
Motif
Other DBs
NCBI-ProteinID: ABJ11331
UniProt: A0A0H2ZAT8
LinkDB All DBs
Position
complement(3271981..3275283)
Genome map
AA seq 1100 aa AA seqDB search
MARREKPVFLNDPQWYKDAVIYQVHVKSFYDANNDGIGDFAGLIEKLDYIADLGVNTLWL
LPFYPSPRRDDGYDIAQYRGVHSDYGSLADARRFIAEAHRRGLRVITELVINHTSDQHPW
FIRARHAKKGSRARDYYVWSDSDEKYQGTRIIFIDTEQSNWTWDPVAQQYYWHRFYSHQP
DLNFDNPQVLREVLGVMRYWLDMGVDGLRLDAIPYLIERDGTSSENLPETHQVLKRIRAE
LDAHYPDRMLLAEANQWPEDTRPYFGGEDGGEGDECHMAFHFPLMPRMYMAIAQEDRYPI
TDILRQTPDIPANCQWAIFLRNHDELTLEMVTDDERDYLWNHYAADRRARLNLGIRRRLA
PLVERDRRRIELLHSLLLSMPGTPTLYYGDEIGMGDNIYLGDRDGVRTPMQWSVDRNGGF
SRADPAKLVLPPILDPLYGYQTINVEAQARDPHSLLNWMRRLLAVRSQQKAFGRGSLKML
APSNRRILAYLREYAEGERQDSILCVANLSRAAQAVELDLASHAGKVPVEMIGGMSFPPI
GELTYLLTLPPYGFYWFYLADATQMPSWHVAADERLPELPTLVVKQRLGELLQGASRNIL
EGETLPAYLPKRRWFAGEKGQPRLCYIVPLDEAEPRCALCEVEIDGLRYQLPLGFLDADQ
RGDSLPQLLALARLRRGRKVGLLTDAASLPLFARKVLAQLRAEAVIAHGDGEIQFIPAAG
LAELDDIADEDVLPFSVEQSNSSIRFGERMVLKVLRKILPGLHPEIEVGGYLTRHGYPGI
APLLGEVRRVGADGEPHTLMILQGYLNNQGDAWNWTLDNLERAVRDEISAASEALEGQYD
SLAELRGFAANLGARLGEMHSVLAGESDDPAFGSRESDEASVQAWALRIAEQLREAGKRL
SEPPRPLQGEAAEQARRLLERLPALLERLPLLARQAAGGLLIRVHGDLHLGQVLMVQGDA
RFIDFEGEPARSLEERRQRHSPMKDVGGMLRSFDYAAAMVLRNAQSTDSSEQADSARRKV
AMRYRSEARDAFLVGYRAAAAGLAHAWHGREGEGAALVLACLEKAAYELLYEADYRPDWL
EVPLAGLAELTEHLLKGKNR
NT seq 3303 nt NT seq  +upstreamnt  +downstreamnt
atggccagacgcgagaaaccggtctttctcaacgacccgcaatggtacaaggacgcggtg
atctaccaggtccacgtgaaatccttctacgacgccaacaacgatggcatcggcgacttc
gccgggctgatcgagaagctcgactacatcgccgacctcggcgtgaacactctctggctg
ctgccgttctacccgtcgccacgccgcgacgacggctacgacatcgcccagtaccgtggc
gtgcacagcgactatggcagcctcgccgacgcccgccggttcatcgccgaggcccatcga
cgcggtctgcgggtgattaccgagctggtgatcaaccacacctccgaccagcatccctgg
ttcatccgcgcccgccacgcgaagaaggggtcgcgcgcccgcgactactacgtctggtcg
gacagcgacgagaaataccagggtacgcggatcatcttcatcgacaccgagcagtccaac
tggacctgggacccggtagcccaacagtactactggcaccgcttctattcccaccagccg
gacctgaacttcgacaacccgcaggtcctgcgcgaggtcctcggggtgatgcgctactgg
ctggacatgggcgtcgacggcctgcgcctggacgcgattccctacctgatcgaacgcgac
ggcaccagcagcgagaacctgccggagacccaccaggtgctcaagcgcatccgcgccgag
ctggacgcgcactatcccgaccgcatgctgctggccgaggccaaccagtggccggaagac
acccggccgtacttcggcggcgaggatggcggcgagggcgacgaatgccacatggccttc
cacttcccgctgatgccgcgcatgtacatggccatcgcccaggaggatcgctatccgatc
accgacatcctgcgccagaccccggacatcccggccaattgccaatgggcgatcttcctg
cgcaaccacgacgagctgaccctggagatggtcaccgacgacgagcgcgactatctctgg
aaccactatgccgccgaccgccgcgcgcgcctcaacctgggcatccgccggcgcctggcg
ccgctggtggagcgtgaccggcggcgcatcgagctgctgcacagcctgctgttgtcgatg
ccgggcacgccgaccctgtactacggcgacgagatcggcatgggcgacaacatctacctc
ggcgaccgcgacggcgtgcggaccccgatgcagtggtcggtggaccgcaacggcggcttc
tcccgcgccgacccggcgaagctggtgctgccgccgatcctcgacccgctgtacggctac
cagacgatcaacgtcgaggcgcaggcgcgcgacccgcattcgctgctcaactggatgcgc
cgcctgctcgccgtgcgcagccagcagaaggccttcggccgcggcagcctgaagatgctc
gcgccgagcaaccgacggatcctcgcctacctgcgcgaatacgccgagggcgaacggcag
gacagcatcctctgcgtggccaacctgtcgcgcgcggcccaggcggtggaactggacctc
gccagccatgccggcaaggtgccggtggagatgatcggcggcatgtcgttcccgccgatc
ggcgagctgacctacctgctgaccctgccgccctacggcttctactggttctacctggcc
gacgcgacgcagatgccgagctggcacgtggccgccgacgagcgcctgccggaactgccg
accctggtggtcaagcagcgcctcggcgagctgctgcagggcgcatcgcggaacatcctg
gaaggcgagacactgccggcctacctgccgaagcgccgctggttcgccggcgagaaaggc
cagccacggctctgctacatcgttccgctggacgaggcggagccgcgctgtgcgctgtgc
gaagtggagatcgacgggctgcgctaccagttgccgctgggcttcctcgacgccgaccag
cgcggcgacagcctgcctcagttgctggccctggcgcgcctgcggcgcgggcgcaaggtc
ggcctgctgaccgacgccgccagcctgccgctgttcgcccgcaaggtcctcgcgcaactc
cgcgccgaggcggtgatcgcccacggcgacggcgagatccagttcatcccggcggcggga
ctggcggaactggacgacatcgccgacgaagacgtcctgccgttctcggtggaacagtcc
aacagctcgatccgcttcggcgagcgcatggtcctcaaggtgctgcgcaagatccttccg
gggctgcacccggaaatcgaggtcggcggctacctgacccgccacggctaccccggcatc
gccccgttgctcggcgaggtacggcgggtcggcgcggatggcgagccgcacacgctgatg
atcctgcagggctacctgaacaaccagggcgacgcctggaactggaccctggacaacctg
gagcgagccgtgcgcgacgagatatccgcggccagcgaggcgctcgaagggcaatacgac
agcctcgccgaactgcgcggcttcgccgccaacctcggcgcccggctcggcgagatgcac
agcgtactggccggcgagtcggacgatccggccttcggcagccgcgagagcgacgaagcc
agcgtccaggcctgggcgctgcgcatcgccgaacagttgcgcgaagccggcaaacgcctg
agcgagccgccacggccgttgcagggcgaggcggcggaacaggcgcggcgcctgctggaa
cgcctgccggcgctgctcgaacgcctgccgctgctggcccggcaagcagccggcgggctg
ctgatcagggttcacggcgacctgcacctgggccaggtgctgatggtccagggcgacgca
cgcttcatcgacttcgagggcgagccggcgcgcagcctggaagagcgccgccagcgccac
agtccgatgaaggacgtcggcggcatgctgcgctcgttcgactacgcggcggcgatggtc
ctgcgcaacgcgcagagcaccgatagctcggaacaggccgacagcgcccggcgcaaggtc
gccatgcgctatcgcagcgaagcccgcgacgccttcctggtcggctaccgcgccgccgca
gcgggcctcgcgcacgcctggcacggccgcgaaggcgagggcgcggcgctggtcctggcc
tgcctggaaaaggccgcctacgaactgctctacgaagccgactaccgccccgactggctg
gaagtgcctctcgccggtctggccgaactcaccgaacacctcctgaagggcaagaaccga
tga

DBGET integrated database retrieval system