KEGG   Pseudomonas aeruginosa UCBPP-PA14: PA14_42950
Entry
PA14_42950        CDS       T00401                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K11894  type VI secretion system protein ImpI
Organism
pau  Pseudomonas aeruginosa UCBPP-PA14
Brite
KEGG Orthology (KO) [BR:pau00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pau02044]
    PA14_42950
Secretion system [BR:pau02044]
 Type VI secretion system
  Imp/Vas secretion system related proteins
   PA14_42950
SSDB
Motif
Pfam: FHA
Other DBs
NCBI-ProteinID: ABJ10850
UniProt: A0A0H2Z941
LinkDB
Position
complement(3818469..3819662)
AA seq 397 aa
MELVLEMLSAKQFVPTELCSKTFGRNGGLIGRGGECDWAIPDRKRHLSKQHARVSYRNGA
FYLTDTSSNGIRAGNGSRLPHGEPQRIEQDSVFLLGDFEIRARLLREPDELAMDVGRPQP
AGSIIPDDAFLALDPLQALDQDGADAYELDDLSAIAQPSQEAGARADYARIDMESLVVPE
LVPAPAAPQEPVESPRPGHDEAFWQRFGQALGMDLEGLDGAAREALAINAAGLLRQCIGG
LQQSLRTRSELKNELRLSLSTLRDTGKNPLRFSADAGEALGHLLRDGKPGQLSGEQAVAR
SFRDLQAHQVALLGASRAAVRATLEHFSPQQLTLRFERDGRRPLLATSGSRWRAYGRYHQ
SLCQDDDWSERLLARDFAQAYEEQVRLISTLYTEHQG
NT seq 1194 nt   +upstreamnt  +downstreamnt
atggaactggtattggaaatgctcagcgccaagcaattcgtaccgacggagctgtgcagc
aagaccttcggcaggaacggcggcctcatcggccgcggcggtgagtgcgactgggcgatt
cccgatcgcaagcggcacctgtccaagcagcatgcgcgggtcagctatcgcaacggcgcg
ttctacctgaccgacaccagcagcaacggcatccgcgccggcaacggcagccgcctgccg
catggcgagccgcagcgcatcgagcaggacagcgtcttcctgctcggcgacttcgagatc
cgcgcgcggttgctgcgcgagcccgacgagctcgccatggacgtcgggcggccgcagccg
gcgggcagcatcattccggacgatgccttcctggccctcgatccgttgcaggcgctcgac
caggacggtgcagatgcctacgaactcgacgacctgagcgcgattgcccagcccagccag
gaggccggggcgcgtgcggactacgcgcggatcgacatggaaagcctggtcgtaccggag
ctggtgcccgccccggcggctccgcaggaacccgtggaaagtccgcgtccgggtcacgac
gaagccttctggcagcgtttcggccaggccctgggaatggacctcgaaggcctcgacggc
gctgcgcgcgaagcgctggcgatcaacgccgccggtttgctgcggcagtgcatcggcggc
ttgcagcagagcctgcggacccgcagcgaactgaagaacgaactgcgcctgtcgctgagc
acgttgcgcgataccggcaagaatcccttgcgcttcagcgccgatgccggcgaggcgctg
ggtcatctgctacgggatggcaagcctggccagttgagtggcgaacaggccgtcgcacgc
agtttccgcgacctccaggcgcaccaggtggcgctgctcggcgccagccgggcggcggtg
cgcgcgaccctcgagcatttctcgccgcagcagctgaccctgcgtttcgagcgcgacggc
cgccggccgttgctggccacctcgggcagccgctggcgtgcctatggtcgctaccaccag
tcgctatgccaggacgacgactggagcgagcgcctgctggcacgtgatttcgcccaggcc
tacgaagagcaggttcgcctgatttccaccctctacaccgagcaccaaggatga

DBGET integrated database retrieval system