KEGG   Pseudomonas aeruginosa UCBPP-PA14: PA14_43110Help
Entry
PA14_43110        CDS       T00401                                 

Definition
(GenBank) putative glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
pau  Pseudomonas aeruginosa UCBPP-PA14
Pathway
pau00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:pau00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    PA14_43110
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pau02000]
    PA14_43110
Enzymes [BR:pau01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     PA14_43110
Transporters [BR:pau02000]
 Other Transporters
  Pores ion channels [TC:1]
   PA14_43110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_C GST_N_2 GST_C_2 GST_C_3 GST_C_6 GST_N_4
Motif
Other DBs
NCBI-ProteinID: ABJ10836
UniProt: A0A0H2Z9L7
LinkDB All DBs
Position
complement(3841020..3841622)
Genome map
AA seq 200 aa AA seqDB search
MYKVYGDYRSGNCYKIKLAMSLLGIDYQWVPVDILKGETQTPEFLAKNPNGKIPVLELED
GSCLWESNAILNFLADGSALLPSEPRLRTQVLQWQFFEQYSHEPYVAVARFIKLYLGLPE
ARRAEFEEKKIGGYKALDVMEKQLSRTPFLVGEQFSIADITLYAYTHVAHEGGFDLTAYP
AIRAWIKRVGEVPGYVGMLD
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgtacaaggtctacggtgattaccgttcgggcaactgctacaagatcaagctggccatg
tcgctgctcggcatcgactaccagtgggtaccggtggacattctcaagggcgagacccag
accccggagttcctggcgaagaaccccaacggcaagataccggtgctggagctggaggac
ggcagttgcctgtgggagtccaacgccatcctcaacttcctcgccgacggcagcgccctg
ttgcccagcgaaccgcgcctgcgcacccaggtgctgcaatggcaattcttcgagcaatac
agccatgagccctatgtggccgtggcgcgcttcatcaagctctacctcggcctcccggaa
gcccgccgcgccgagttcgaagagaagaagatcggcggctacaaggccctcgacgtcatg
gagaaacagctgtcgcgcacgccattcctggtcggcgaacagttctccatcgccgatatc
accctctacgcctacacccatgtcgcccatgaaggcggcttcgacctgacggcctacccg
gcgatccgcgcgtggatcaagcgagtgggggaggtgccggggtatgtggggatgctggat
tga

DBGET integrated database retrieval system