KEGG   Pseudomonas aeruginosa UCBPP-PA14: PA14_56780Help
Entry
PA14_56780        CDS       T00401                                 

Gene name
sodB
Definition
(GenBank) iron superoxide dismutase'
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
pau  Pseudomonas aeruginosa UCBPP-PA14
Brite
Enzymes [BR:pau01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     PA14_56780 (sodB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: ABJ13636
UniProt: A0A0H2ZGT4
LinkDB All DBs
Position
5057249..5057830
Genome map
AA seq 193 aa AA seqDB search
MAFELPPLPYEKNALEPHISAETLEYHHDKHHNTYVVNLNNLIPGTEFEGKSLEEIVKSS
SGGIFNNAAQVWNHTFYWNCLSPNGGGQPTGALADAINAAFGSFDKFKEEFTKTSVGTFG
SGWGWLVKKADGSLALASTIGAGNPLTSGDTPLLTCDVWEHAYYIDYRNLRPKYVEAFWN
LVNWDFVAKNFAA
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atggctttcgaattgccgccgctgccttacgaaaagaacgcccttgagccgcacatttcc
gcagaaaccctggaataccaccacgacaagcaccacaacacctacgtggtgaacctgaac
aacctgatcccgggtaccgagttcgaaggcaagagcctcgaagagatcgtcaagagctcc
tccggcggcatcttcaacaacgccgcccaggtgtggaaccacaccttctactggaactgc
ctgagcccgaacggcggtggccagcccaccggcgccctggccgacgccatcaacgccgcc
ttcggctccttcgacaagttcaaggaagagttcaccaagacttccgtcggcaccttcggt
tccggctggggctggctggtgaagaaggccgacggctccctggccctggccagcaccatc
ggtgccggcaacccgctgaccagcggcgacaccccgctgctgacctgcgacgtctgggaa
cacgcctactacatcgactaccgcaacctgcgtccgaagtacgtcgaggcgttctggaac
ctggtcaactgggacttcgtagcgaagaatttcgctgcctga

DBGET integrated database retrieval system