KEGG   Pseudomonas aeruginosa UCBPP-PA14: PA14_59980
Entry
PA14_59980        CDS       T00401                                 

Definition
(GenBank) hypothetical protein
Organism
pau  Pseudomonas aeruginosa UCBPP-PA14
SSDB
Motif
Pfam: DUF1525 Thioredoxin_3 RPN13_C YceD
Other DBs
NCBI-ProteinID: ABJ13906
UniProt: A0A0H2ZHI3
LinkDB
Position
5341357..5341788
AA seq 143 aa
MPLHHSPPGRRPPTLAVGVLLVLLSSASQAETWVITDKAHPVSATGSSRVLFLDAQEHLE
EQLTAALPQDPQHAQAAFKRLLQSPDGRRLQAELVKAQQDVADAWSLGVEKIPAVVVDRQ
YVVYGEPDVSRALELIAKARRSR
NT seq 432 nt   +upstreamnt  +downstreamnt
atgcctcttcatcactccccccctggccggcggccaccaacgctggccgttggcgtacta
ctggtactgctgagcagcgcgagtcaggccgaaacctgggtcatcaccgacaaggctcat
ccggtctctgccaccggatcgtcgcgcgttctgtttctggacgcccaggaacacctcgag
gagcaactgactgcggccttgccccaggatccacagcatgctcaagcggcgtttaagcga
ttgctacaaagccccgatgggcgccgcctgcaggcagagctggtcaaggcacaacaagac
gtcgccgatgcgtggagtctcggtgtcgagaagatccctgccgtagtagtcgataggcag
tacgtggtctacggcgaaccggatgtttcgcgcgctcttgagctaatcgccaaggccagg
aggtcgcgctga

DBGET integrated database retrieval system