KEGG   Pistricoccus aurantiacus: FGL86_01330
Entry
FGL86_01330       CDS       T06130                                 

Definition
(GenBank) HAMP domain-containing protein
  KO
K07639  two-component system, OmpR family, sensor histidine kinase RstB [EC:2.7.13.3]
Organism
paur  Pistricoccus aurantiacus
Pathway
paur02020  Two-component system
Brite
KEGG Orthology (KO) [BR:paur00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    FGL86_01330
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:paur01001]
    FGL86_01330
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:paur02022]
    FGL86_01330
Enzymes [BR:paur01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     FGL86_01330
Protein kinases [BR:paur01001]
 Histidine kinases
  OmpR family
   FGL86_01330
Two-component system [BR:paur02022]
 OmpR family
  RstB-RstA
   FGL86_01330
SSDB
Motif
Pfam: HATPase_c HisKA HAMP HATPase_c_3 HATPase_c_2 DUF2275 HemY_N
Other DBs
NCBI-ProteinID: QEA40774
UniProt: A0A5B8SXH7
LinkDB
Position
complement(284701..286356)
AA seq 551 aa
MPRPLAESTFLRVYVMLALALVLTFGLALVAFTLIDKVRREHYRELLAEAPMTLLTAELG
VLPQESRQAWLDEQSRALGIQLELYEWGTYSLSYFERARLEAGRTLAYQEESQRWILYRR
LPGEQWLLKAELTSMSERQLTGLAQNLGQWLSAVEGEQRRERLERLKNAAFTATLSEQVP
EGLDPERVTRMQDSEVVVRLLPQRWAMSLFLRLPTPEGGIEWVQVGPLKPFEPMSLTLSL
TLLVIMLAVLAGIIYMIVRGLEARVARLELAATRIAGGHLDTRVKVDSSDFLGRLGMAFN
GMAAQVQALLQSQQDMIRGVSHELRTPVARIRFAVQMVEDMIDSPPVRRQLKGIDGDIEE
LDTLIDEILTYARLGGGQVQGMDLKSEEVDCRALAVRVIETLAPLHGRLSLELAPGPEIE
VVAEPRYLQRALQNLVANACRHADSRVMISIKHSLRTVQLAVEDDGPGVPENDRLKVFKP
FSRLDDSRTRRSGGYGLGLSIVQKIMHWHRGSVVIDDSPTLGGARFTLQLPQAALPATPA
EETDFTPTRLV
NT seq 1656 nt   +upstreamnt  +downstreamnt
atgccccgcccgctggcggagagtactttcctgcgtgtctatgtgatgctggcgctggcg
ctggtgctgaccttcggcctggcgctggtcgctttcacgttgatcgacaaggtgcgccgt
gagcattaccgggaactgctggcggaagcgccgatgacgctgctgaccgcggaactcggc
gtgctgcctcaggaaagtcggcaagcatggctcgacgaacaaagccgcgccctgggtatt
caactcgaactatacgaatggggcacttattctctcagctacttcgagcgcgccagactg
gaggccgggcgcaccctggcttatcaggaagaaagccagcgttggatcctgtatcgccgc
ctgcccggggagcaatggctgttgaaggcggaactgaccagtatgagcgaaaggcaactg
accgggctggcgcagaacctggggcagtggctttccgcggtggagggcgaacagcgccgt
gagcgcctcgagcgactgaaaaatgctgcttttaccgccactctgtccgagcaggtaccc
gaagggctggaccctgaaagggtcacgcgcatgcaagacagcgaggtggtggtacgcctg
ctgccccagcgctgggcaatgtcgcttttcctgcgtctgcccacgccggaaggcggtatc
gaatgggtgcaggtaggacccttgaaacccttcgagcccatgtccctgacgctgtccctg
accttgctggtgatcatgctggcggtgctggcgggcatcatctacatgatcgtgcgtggg
ctcgaggcccgagtggcgcggctcgaacttgccgccacgcggattgccggcggccacctg
gatacccgagtcaaggtcgacagcagcgacttcctcggacgtctgggcatggcgtttaac
ggcatggcggcgcaggtccaggcgctgcttcaatcccagcaggacatgattcgcggcgtt
tcccatgaactgcgtacgccggtggcgcggatccgcttcgcggtgcagatggtcgaggac
atgatcgacagcccgccggtgcgccgtcagttaaaaggcatcgatggggatatcgaggaa
cttgatactctgatcgatgagattctgacctatgcgcgcctgggcgggggtcaggtccag
ggcatggatctcaaatccgaggaagtcgattgtcgagccctggcggtgcgtgtcatcgag
accttggcgccgctgcacggccggctctctctcgagctggcaccggggccggaaatcgaa
gtggtggcggagccgcgctatctgcagcgcgcgttgcagaacctggtggccaacgcctgt
cgccacgcggactcccgggtgatgatcagcatcaagcatagcctgcgcacggtgcaactc
gcggtggaggacgacggtcccggggtgccggaaaacgaccgtctcaaggtcttcaagcct
ttctctcgactggacgatagccgcacccgacgctccggcggttacgggctggggctttcc
atcgtgcagaagatcatgcactggcaccggggcagcgtagtgatcgatgatagcccgacc
ttgggtggcgcgcgcttcaccctgcagctacctcaggcggcgttgccggcgacgcctgcg
gaagagaccgacttcacgcccactaggctggtttga

DBGET integrated database retrieval system