KEGG   Pistricoccus aurantiacus: FGL86_06575Help
Entry
FGL86_06575       CDS       T06130                                 

Definition
(GenBank) phosphate ABC transporter ATP-binding protein
  KO
K02036  phosphate transport system ATP-binding protein [EC:7.3.2.1]
Organism
paur  Pistricoccus aurantiacus
Pathway
paur02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:paur00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    FGL86_06575
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:paur02000]
    FGL86_06575
Enzymes [BR:paur01000]
 7. Translocases
  7.3  Catalysing the translocation of inorganic anions and their chelates
   7.3.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.3.2.1  ABC-type phosphate transporter
     FGL86_06575
Transporters [BR:paur02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Phosphate transporter
    FGL86_06575
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran SMC_N AAA_21 AAA_15 AAA_23 AAA_16 AAA_22 RsgA_GTPase AAA_29 Rad17 AAA_33 AAA_24 AAA_18 AAA_30 AAA Adeno_IVa2 Relaxase Tubulin Viral_helicase1 NB-ARC
Motif
Other DBs
NCBI-ProteinID: QEA40841
UniProt: A0A5B8SWN5
LinkDB All DBs
Position
1358452..1359234
Genome map
AA seq 260 aa AA seqDB search
MHTNEDARHELSVRVRDLNLWYGNSQALKNVNIDVYQKNVTAVIGPSGCGKSTFLRCLNR
MNDLIRNVRTEGLIEMDGRDVNEPRMDEVALRRRVGMVFQKPNPFPKSIYENVAYAPRMH
DLVSRKAEQDELVEQALRDAGLWNEVKDKLQQQGTSLSGGQQQRLCIARAIAVQPDVILM
DEPTSALDPISTATIEDLMDRLKQQFTIVTVTHNMQQAARVADYTAFFHLGELIEYNDTR
MMFSNPHTKKAEDYITGRYG
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
gtgcataccaacgaggacgcgcgccacgaattgagtgtccgcgtgcgtgatctcaatctc
tggtatggaaacagccaggcactcaagaacgtcaatatcgatgtctatcagaagaacgtc
accgcggtgatcggcccctccggctgtggcaagtcgacctttctacgttgcctgaatcgc
atgaacgatctgattcgcaatgtcaggacagaagggctgatcgagatggacgggcgggat
gtcaacgagcccaggatggatgaggtcgccctgcgccgacgagtaggcatggtattccag
aagcccaatccgtttcccaagtcgatctacgagaacgtcgcctacgcgccgcgcatgcac
gatctggtgagccgcaaggcggaacaggatgagctggtggagcaggcgctacgcgatgcc
gggctgtggaacgaggtcaaggacaagcttcagcaacagggcacctccctgtccggcggc
cagcagcagcgcctgtgcattgcccgggcgatcgcggtgcagccggacgtgatcctgatg
gacgagccgacctcggcgctggacccgatctccacggcgaccatcgaggacctgatggac
aggctcaagcagcagttcaccatcgtcacggtgacccacaacatgcagcaggcggcgcgg
gtggccgactacacggccttcttccacctcggcgagctgatcgagtacaacgatacgcgg
atgatgttctccaacccgcataccaagaaggccgaggactacatcaccgggcgctatggc
tag

DBGET integrated database retrieval system