KEGG   Propionibacterium australiense: NCTC13651_01488
Entry
NCTC13651_01488   CDS       T06637                                 

Gene name
uppS
Definition
(GenBank) Undecaprenyl pyrophosphate synthase
  KO
K21273  trans,polycis-polyprenyl diphosphate synthase [EC:2.5.1.88]
Organism
paus  Propionibacterium australiense
Pathway
paus00900  Terpenoid backbone biosynthesis
paus01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:paus00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    NCTC13651_01488 (uppS)
Enzymes [BR:paus01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.88  trans,polycis-polyprenyl diphosphate synthase [(2Z,6E)-farnesyl diphosphate specific]
     NCTC13651_01488 (uppS)
SSDB
Motif
Pfam: Prenyltransf
Other DBs
NCBI-ProteinID: VEH90935
UniProt: A0A383S915
LinkDB
Position
1:1686572..1687246
AA seq 224 aa
MDGNGRWAKARGMARTKGHEVGEKVLIEVLQGAIEMGIGTLSVYAFSTENWRRSPDEVRF
LMGFSRRMIHTHRDFMDELGVQVIWAGRKPKLWTSVLHELQAAEAQTRGNTVINLQLCLN
YGGRAEIADAMAAMGRDVRDGRLNPDRISEKTVQRYLYHPEAGDVDLFIRTSGEQRTSNF
LLWQSAYAELLFSDKLWPDWDRRDLWAAVEQYARRDRRFGGAQA
NT seq 675 nt   +upstreamnt  +downstreamnt
atggacggcaacgggcgctgggcgaaggcccgcggcatggcccggacgaagggtcacgag
gtgggtgagaaggtacttatcgaggtgctgcagggcgccatcgagatgggtatcggcacc
ttgtcggtgtacgccttcagcaccgagaactggcgccgctcccccgacgaggtccgcttc
ctcatgggcttcagccgccgtatgatccacacccaccgggacttcatggacgagctgggc
gtgcaggtgatctgggcgggacgcaagccgaagctgtggacgagcgtgctgcacgagctg
caggccgccgaggcccagaccaggggcaacaccgtgatcaaccttcagctgtgcctcaac
tacgggggacgcgccgagatcgccgacgcgatggcggccatgggccgcgacgtccgggac
ggcaggctcaaccccgaccggatcagcgagaagacggtgcagcgatacctgtaccacccg
gaggccggtgacgtggacctgttcatccgcacctccggcgagcagcggacgagcaatttc
ctgctgtggcagagcgcctacgccgagctgctgttcagcgacaagctctggcccgactgg
gaccgccgcgatctgtgggccgccgtggagcagtacgcccgccgggaccgccggttcggt
ggggcccaggcctga

DBGET integrated database retrieval system