KEGG   Propionibacterium australiense: NCTC13651_02638
Entry
NCTC13651_02638   CDS       T06637                                 

Definition
(GenBank) Uncharacterised protein
  KO
K20370  phosphoenolpyruvate carboxykinase (diphosphate) [EC:4.1.1.38]
Organism
paus  Propionibacterium australiense
Pathway
paus00620  Pyruvate metabolism
paus01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:paus00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    NCTC13651_02638
Enzymes [BR:paus01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.38  phosphoenolpyruvate carboxykinase (diphosphate)
     NCTC13651_02638
SSDB
Other DBs
NCBI-ProteinID: VEH92854
UniProt: A0A383S6T5
LinkDB
Position
1:2987459..2990857
AA seq 1132 aa
MTAQDRSRINAAINLRLSLLGLPLPENADGSAETAMVEPLLARQRELSRRLNQQLSAPDK
RVQAFLDDYLSDTGLQPQLPRTTLVLDEPGLARGLSLPVDGDEFHSPVIESYRLVNGVLH
NPKNDRRTTAGVFHIATGGLPIPEDKIEVDKTVFARILEAALQAPDDELMLPYTANMTTP
ARCWVSLLMHPIVVPEVPGRARRRSYEVRFIAPGGLVANLDFVEAIFGNGGDPYLPENDA
SLDPATWTGTTGCVILAPHLVGSLTKKDLGLPSWDEATERQRRDGQCWKSADELYNDGKS
FKVCARDERGVIVTVLADNYFGYCKKEVKTQISYSANLLGSAEEEHSGGAITYPAWNLGV
EFTDRTPDGWTLDDALARNPDRFAVQPEGHAIDRKWPNIVLVPEHARFSMREQRISWTRG
GVEQSIKLLADKQYLSPDGYRVHAKHREMDATQWHLIGVLQDATQCHKPATVSGGGKSEI
SKSIADAFQFGNAHVSDFEADMDAVDELFRLDYCNRFADDSLNGTDHRPVLSRERSLGSV
IKLLTPSRAYTEEYNTFLRGIRQDVKELAFIVKRHYRPEWGDDWRSHFTVDTMNGHHGNM
VRLDGEKVIVNMLRVGFEPDGSWRIFSLRPDFSPAVKVQSEDDITASTVTPPWGDPEAMP
RKYVENCEMLLFQRPDDAIHRGYDKQAEADLSGGEDTFISNFEPLTRAQAREMLTDVQAL
SEFTKPVQDLIAKAAAGADDESPAFWTCSDEPRHLPDGTRSRNPRYLQRRPVDANPELTA
VADVASKLFLKLPMDEPAPLPVDLVAAGRRNNPPEGRIPPLCAYNPLHYMELPELFMEFI
SSMTGKSPSTTGAGSEGALTKGPFNALAPIIDLNSALLSYVLTGYDGWLSSAGCIGPNVR
VDHDISMLVPELFSHMKPHERDAKTLIEQGFLDKLEDFEFNGRTVQASRLGYRMNDRLAT
TYFGRIFLHPDVVFTDEMLRPELQDEQVYADSIDVIVATHQRVAQLYIDDGTISQAIPPL
KGLLEIMANGQTAEGWTLSSPEFRELFTRESVLASDWYAARLDAMQAEELRLTHEGITRL
REYTERPDAFSTAERVGLPQRLAALEEDAKRIASDEYRASLVGTLGRQVSFR
NT seq 3399 nt   +upstreamnt  +downstreamnt
atgaccgcacaggaccgttcacgcatcaatgcagccatcaacctccgcctgtcgctcttg
ggtctgccgctgccggagaatgccgacggaagcgccgagaccgccatggtcgagccgctc
ctcgcccgccagcgcgagctgagccgccgactcaaccagcaactgagcgcccctgacaag
cgtgtccaggccttcctcgacgattacctgtccgacaccggactgcagccgcagctgccc
cgcacgacgctcgttctcgacgagccgggcctggcccgcggcctgtcgctgccggtggac
ggcgacgagttccactcccccgtcatcgagtcctaccggctcgtcaacggggttctgcac
aacccgaagaacgatcgccgcaccacggccggtgtcttccacatcgccaccggcggcctg
ccgatccccgaggacaagatcgaggtcgacaagaccgtgttcgcccgcatcctcgaggcg
gctctgcaggcccccgacgacgagctgatgctgccgtacaccgcgaacatgacgacgccg
gcccgctgctgggtctcgctgctcatgcacccgatcgtcgtccccgaggtgcccgggcgc
gcccgccgccgcagctacgaggtgcgtttcatcgcgccgggcggcctggtcgccaatctc
gacttcgtcgaggccatcttcggcaacggcggcgacccctacctgcccgagaacgacgcc
tcgctcgacccggccacgtggaccggcacgaccggctgcgtcatcctggcgccccacctg
gtgggttccctcacgaagaaggacctggggctgccctcctgggacgaggccaccgagcgt
cagcgccgggacggccagtgctggaagagcgccgacgagctctacaacgacggcaagtcc
ttcaaggtctgcgcccgcgacgagcgcggcgtcatcgtcaccgtgcttgccgacaactac
ttcggctactgcaagaaggaggtcaagacccagatctcctactcggcgaatctgctgggc
tcggccgaggaggagcattccggtggcgcgatcacctatccggcgtggaacctgggtgtc
gagttcaccgaccgcacccccgacggctggacgctcgacgacgccctggcccgcaacccc
gaccgtttcgcggtgcagccggagggccacgccatcgaccggaagtggccgaacatcgtc
ctcgtgccggagcacgcgcgcttctcgatgcgcgagcagaggatctcgtggaccaggggc
ggtgtcgagcagtccatcaagctgctcgccgacaagcagtacctgtcccccgacggctac
cgggtgcacgccaagcaccgtgagatggacgccacccaatggcacctgatcggtgtgctg
caggacgccacccagtgccacaagccggcgaccgtctccggcggcggaaagtcggagatc
tccaagtcgatcgccgacgccttccagttcggcaacgcacacgtctccgacttcgaggcc
gacatggacgccgtcgacgagttgttccggctggactactgcaaccgcttcgccgacgac
tccctcaacggcaccgaccaccggcccgtgctgagcagggagcgcagcctcgggtcggtc
atcaagctgctgacgccctcgcgcgcctacaccgaggagtacaacaccttcctgcgcggc
atccgccaggacgtcaaggagctggcgttcatcgtcaaacgccactaccgccccgagtgg
ggtgacgactggcgttcgcacttcaccgtcgacaccatgaacggccaccacggcaacatg
gtgcggctggacggcgagaaggtcatcgtcaacatgctgcgcgtcggtttcgagccggac
ggctcgtggcgcatcttcagcctgcgccccgacttcagcccggcggtcaaggtgcagtcc
gaggacgacatcaccgccagcaccgtcaccccgccgtggggggaccccgaggcgatgccc
cgcaagtacgtcgagaactgcgagatgctgctcttccagcgtcccgacgacgccatccac
cgcggctacgacaagcaggccgaggcagacctgtctggtggcgaggacaccttcatctcg
aacttcgagcccctcaccagagcgcaggcccgcgagatgctcaccgacgtgcaggcgctc
agcgagttcaccaagcccgtccaggacctcatcgcgaaggcagcggctggcgccgacgac
gagtccccggccttctggacctgctccgacgagccgcgccacctgcccgacggcacgcgg
tcgaggaatccccgctatctgcagcggcgcccagtcgacgccaacccggagctgacggcg
gtggccgacgtggccagcaagctgttcctcaagctgccgatggacgagccggccccgctg
ccggtcgacctggtggcggcgggccggcgcaacaacccgcccgagggcaggatcccgccg
ctgtgcgcctacaacccgctgcactacatggagctccccgagctgttcatggagttcatc
agctcgatgaccggcaagtcgccgtccacgaccggagcgggctccgagggcgccctgacg
aagggcccgttcaacgcgctggccccgatcatcgacctcaactcggcgctgctcagctac
gtgctgaccggctacgacggctggctgagctcggccggctgcatcggcccgaacgtgcgc
gtcgaccacgacatctcgatgctggtgcccgaactgttcagccacatgaagccgcacgag
cgcgacgcgaagaccctcatcgagcagggcttcctcgacaagctcgaggacttcgagttc
aacgggcgcaccgtgcaggcctcgcgcctgggctaccgcatgaacgaccggctcgcgacc
acctacttcggccgcatcttcctgcaccccgacgtggtgttcaccgatgagatgctgcgc
ccggagctgcaggacgagcaggtctacgccgactcgatcgatgtgatcgtcgccacccac
cagcgggtcgcccagctgtacatcgacgacggcacgatctcgcaggcgatccccccgctc
aaggggctgctcgagatcatggccaacgggcagaccgccgagggctggacgctcagctcg
cccgagttccgtgagctgttcacccgcgagtccgtgctggcctcggactggtacgcggcc
cgtctggacgccatgcaggccgaggagctgcgcctgacgcacgagggcatcacgcgtctg
cgcgagtacaccgagcgccccgacgctttctccacggccgagcgcgtcgggctgccgcag
cgtctggccgccctggaggaggacgccaagcggatcgcctctgacgagtaccgcgcctcg
ctggtcggtacgctcggccgccaggtgagcttccgctga

DBGET integrated database retrieval system