KEGG   Pseudonocardia autotrophica: Pdca_11520
Entry
Pdca_11520        CDS       T06156                                 

Gene name
gabT
Definition
(GenBank) aspartate aminotransferase family protein
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
paut  Pseudonocardia autotrophica
Pathway
paut00250  Alanine, aspartate and glutamate metabolism
paut00410  beta-Alanine metabolism
paut00640  Propanoate metabolism
paut00650  Butanoate metabolism
paut01100  Metabolic pathways
paut01120  Microbial metabolism in diverse environments
Module
paut_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:paut00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    Pdca_11520 (gabT)
   00650 Butanoate metabolism
    Pdca_11520 (gabT)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Pdca_11520 (gabT)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Pdca_11520 (gabT)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:paut01007]
    Pdca_11520 (gabT)
Enzymes [BR:paut01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     Pdca_11520 (gabT)
Amino acid related enzymes [BR:paut01007]
 Aminotransferase (transaminase)
  Class III
   Pdca_11520 (gabT)
SSDB
Motif
Pfam: Aminotran_3
Other DBs
NCBI-ProteinID: BBF99942
LinkDB
Position
1170209..1171465
AA seq 418 aa
MAQLSPLLKQATPVQAARGEGVYLFDTDGRRHLDFTAGIGVTSTGHCHPAVVKAAQDQVA
TLIHGQYTTVMHQPLLKLAERLGEVLPEGIDSVFFSNSGSEAVEASVRLARQATGRPLVL
AFDGGFHGRTMGAAALTTSGAKIRAGIGPLMGGVAFAPFPYAYRHGWTEEQAVEFALTEL
DRQLASTAPVSDVAAFIVEPVLGEGGYVPTPAAFLQGLRERADRHGILLIADEVQTGFGR
TGKFWGHQHAEGVVPDIIVTAKGLASGFPLSAIAAPKAIMEKAWPGSQGGTYGGNAVACA
AALATLDVVLGENLVENSRVQGERLVAGVRDAAQGIAAIGDVRGRGLMVGIEFVDAQGKP
DGATAAKVHAAAAEHGLLLLTCGVYGNVVRMIPPLVVTAEQVDEGLALWTKALTDALS
NT seq 1257 nt   +upstreamnt  +downstreamnt
atggcacagctgtccccgctgctgaagcaggccaccccggtccaggccgcccgcggtgag
ggcgtctatctgttcgacaccgacgggcgacgccacctggacttcaccgcaggcatcggc
gtcacctcgaccgggcactgccacccggctgtcgtcaaggccgcgcaggaccaggtcgcg
acgctgatccacggccagtacacgacggtcatgcaccagccgctgctgaagctggccgag
cggctcggcgaggtgctgcccgagggcatcgactcggtcttcttctccaactccggttcg
gaggccgtcgaggcgtcggtgcggctcgcccgccaggccaccggccggccgctcgtgctc
gccttcgacggcgggttccacggccgcacgatgggtgcggccgcactcaccacctccggc
gccaagatccgcgccgggatcggtccgttgatgggcggcgtggcgttcgcgccgttcccg
tacgcctaccggcacggctggaccgaggagcaggcggtcgagttcgcgctgaccgagctg
gaccggcagctggcgagcaccgcgccggtgtcggatgtcgcggccttcatcgtggagccg
gtgctcggcgagggtggctacgtgccgaccccggcggcgttcctgcagggcctgcgcgag
cgggccgaccggcacgggatcctgctgatcgccgacgaggtgcagaccgggttcggccgc
accggcaagttctggggacaccagcacgccgagggcgtcgtcccggacatcatcgtcacc
gccaagggcctggcgtccggcttcccgctgtcggccatcgccgcgccgaaggcgatcatg
gagaaggcgtggcccggctcgcagggcggcacctacggcggcaacgcggtcgcctgcgcc
gccgcgctggccacgctggacgtggtgctcggtgagaacctggtggagaactcccgggtg
cagggtgagcggctggtcgccggtgtccgggatgcggcgcagggcatcgccgcgatcggc
gacgtccgcggccgcggcctgatggtcggcatcgagttcgtcgacgcgcagggcaagccg
gacggcgcgaccgccgcgaaggtgcacgccgccgcggccgagcacgggctgttgctgctg
acctgcggggtgtacggcaacgtggtgcggatgatcccgccgctggtcgtcaccgccgag
caggtcgacgagggactggcgctctggaccaaggcactgaccgacgcgctctcctga

DBGET integrated database retrieval system