KEGG   Cutibacterium acnes TypeIA2 P.acn17: TIA2EST22_04390Help
Entry
TIA2EST22_04390   CDS       T01654                                 

Definition
(GenBank) L-xylulose 5-phosphate 3-epimerase
  KO
K03079  L-ribulose-5-phosphate 3-epimerase [EC:5.1.3.22]
Organism
pav  Cutibacterium acnes TypeIA2 P.acn17
Pathway
pav00040  Pentose and glucuronate interconversions
pav00053  Ascorbate and aldarate metabolism
pav01100  Metabolic pathways
pav01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pav00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    TIA2EST22_04390
   00053 Ascorbate and aldarate metabolism
    TIA2EST22_04390
Enzymes [BR:pav01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.22  L-ribulose-5-phosphate 3-epimerase
     TIA2EST22_04390
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AP_endonuc_2
Motif
Other DBs
NCBI-ProteinID: AEW81198
LinkDB All DBs
Position
932442..933329
Genome map
AA seq 295 aa AA seqDB search
MTESLTDGVTLGIYEKALVGNPLATDDDWRRFLNQVPEAGFSFVDLSVDESEERMARLGW
DQRRRRMVRHCVEATETAIGGVCLSVHRRIGPGSADPAVRQRAREVMGEGLQLCHDLGAP
VLQVAGYYCYYEQMNDHAEQWYTDLLLDAVPMAARLGVVMGIENVDGTDVTSIRKAMEFV
KLADSPYLQVYPDLGNIAEQQLDVVTELEAGRGHMVAIHVKDVRPGEPRRVPMGEGTVDW
DESFAVLAEQGWRGRMMIEMWNDDAPDSNTRSASARQFIEEHLRTAGIPVRRALF
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaatcgctgaccgacggggtgaccctcggcatctatgagaaagccctcgtcggc
aaccccttggctaccgacgacgactggcgacgcttcctaaaccaggtacccgaggcagga
ttcagcttcgtcgacctgtccgtcgatgagtctgaagagaggatggcacggctcggatgg
gaccagcgccggcgtcgcatggtgcgccattgcgttgaggccacagaaaccgctattggt
ggtgtctgcttgtcggtacatcggcgtattggccctggtagtgccgacccagccgtgcgc
cagcgagctcgggaggtgatgggcgaaggattgcagctgtgccacgaccttggcgctcct
gtgcttcaggtcgcggggtattactgctactacgagcagatgaacgaccatgccgagcag
tggtacaccgacctcctgctcgatgccgtcccgatggctgcacggctgggggtcgtcatg
ggcatcgagaatgttgacggcaccgacgtcacctctatccggaaggcgatggagtttgtc
aagcttgccgactcgccctacctgcaggtgtacccagaccttggcaacattgccgagcaa
cagcttgacgtcgtgaccgaactcgaggccgggcggggccacatggtcgcgatccacgtc
aaggatgttaggccgggcgagcctcgtcgggtaccaatgggggagggcaccgtcgactgg
gacgagtccttcgctgtccttgctgagcagggttggcgcggccgaatgatgatcgagatg
tggaacgacgacgctcccgattccaacacgcgcagtgcgtcagcacgccagttcatagag
gagcatcttaggaccgctggaatcccggttcgccgcgccctcttttga

DBGET integrated database retrieval system