KEGG   Cutibacterium acnes TypeIA2 P.acn17: TIA2EST22_04920Help
Entry
TIA2EST22_04920   CDS       T01654                                 

Gene name
aceE
Definition
(GenBank) pyruvate dehydrogenase subunit E1
  KO
K00163  pyruvate dehydrogenase E1 component [EC:1.2.4.1]
Organism
pav  Cutibacterium acnes TypeIA2 P.acn17
Pathway
pav00010  Glycolysis / Gluconeogenesis
pav00020  Citrate cycle (TCA cycle)
pav00620  Pyruvate metabolism
pav01100  Metabolic pathways
pav01110  Biosynthesis of secondary metabolites
pav01120  Microbial metabolism in diverse environments
pav01130  Biosynthesis of antibiotics
pav01200  Carbon metabolism
Module
pav_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:pav00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TIA2EST22_04920 (aceE)
   00020 Citrate cycle (TCA cycle)
    TIA2EST22_04920 (aceE)
   00620 Pyruvate metabolism
    TIA2EST22_04920 (aceE)
Enzymes [BR:pav01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.1  pyruvate dehydrogenase (acetyl-transferring)
     TIA2EST22_04920 (aceE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PDH_E1_M Transketolase_N
Motif
Other DBs
NCBI-ProteinID: AEW81301
LinkDB All DBs
Position
1047332..1050085
Genome map
AA seq 917 aa AA seqDB search
MIPREERGPVLNGLPTTLPDVDPEETQEWIESLDKMVETDGPNRARIVLLKMLERARSHS
RLGLSALTSTDYINTIAAEDEEEYPGDAEIERNIRRLLRWNSAITVHRAQRPGIGVGGHI
STYASAVTLYEVGQNHFWRGQDAPGGGDQVFFQGHAAPGMYARAFLEGRLSEDDLDGFRQ
EKSKAGHGLPSYPHPRMLPDFWQFPTVSMGLGPMNSIYQASMNKYLTNRGVKDCADQHVW
AFLGDGEMDEPESRGFLQVAANEELDNLTFVINCNLQRLDGPVRGNGKIVQELEAVFRGA
GWNVIKVIWGSGWDPLLQADRDGALVDIMNNTRDGDYQTFKANDGAYVREHFFGRDPRTA
KMVDKWTDEQIWALRRGGHDYRKIYNAYKAATQFKGAPTVVLACTIKGYDLGTHFAGRNA
THQMKKLALEDLKQFRDRLEIPISDKVLEADPYRAPYFHPGADDERIQYLMERRRALGGF
VPERRTRHTPLPIPAQKAFDGVKRGSGKQEVATTMAFVRLLKDLMRDKNFAPHVVPIIPD
EARTFGMDSFFPTIKIYNPHGQNYTPVDHELMLSYREAKNGQIIHTGINEAGSAAAFIAA
GSAYSTQGVPMVPIYLFYSMFGFQRTGDSFWAAGDQMTRGFIIGATAGRTTLTGEGTQHM
DGHSPVLAATNPAVISYDPAYSYEISHIVQAGLEHMYGENAEDVMYYLTVYNEPIVQPAE
PEGVDAEGIVKGMYLLSKGSFEGVGEDARRVQLLASGVAVPWAIEAQQLLKGDFGVVADV
WSVTSWNNLRRDAMEAEEQTFLHPEQGRRTPYITQCLADAPGPVVATTDYTCQVPDQIAQ
WVPGDYASLGADGFGFSDTRAAARRFFHIDGPSMTVRALQMLVERGEVPEDWPAKAAEKY
DLLNVNAGASGNAGGDA
NT seq 2754 nt NT seq  +upstreamnt  +downstreamnt
gtgatcccacgcgaagaacgcggaccagtcctcaacggacttccgacaaccctgcctgac
gtcgatcccgaggagactcaggagtggatcgagtccctcgacaagatggtcgagactgat
ggtccgaatcgtgcccggatcgtgctgctcaagatgttggagcgggctcgtagccacagt
cgtctcgggctgtcagcgctcacctccaccgactacatcaacaccattgcagccgaggac
gaggaagaataccccggcgacgccgagatcgagcggaacatccgtcgtttgctgcgctgg
aattccgccattaccgtgcatcgcgcgcagcgtcccggtattggcgtcggcggtcatatc
tccacctatgcctctgccgtgaccctctacgaggtcggtcagaaccacttctggcgcggg
caggacgcccccggcggcggtgaccaagttttcttccaggggcacgccgcgcccggtatg
tacgctcgcgcgttcttggaggggcgtctcagcgaggacgatctcgatgggttccgtcag
gagaagtcgaaggccgggcatggtctaccctcttacccgcaccctcgcatgttgcccgac
ttctggcagttcccgacggtgtcgatgggtctgggcccgatgaattccatttaccaggcg
tctatgaataagtacctcaccaatcgcggtgtcaaggactgcgcagatcagcacgtgtgg
gctttccttggcgacggtgagatggacgagccggagtcgcgcggattcctgcaggtcgct
gccaacgaggagctcgacaacctcaccttcgtcatcaactgcaacctgcagcgtctagac
gggccggtgcgtggcaacggcaagattgtccaggaacttgaggctgtcttccgtggtgct
ggctggaacgtcatcaaggtcatttggggatccggctgggacccgttgctgcaggcagac
cgtgacggtgccctcgttgatatcatgaacaacacccgtgatggcgactaccaaaccttt
aaggccaacgacggcgcctatgtccgcgagcacttctttggccgcgacccgcgcactgcc
aagatggtcgacaagtggactgacgaacagatttgggcgttacgccgtggcggtcacgac
taccgcaagatttacaacgcctacaaggcggctacgcagttcaagggagcgccgaccgtg
gtgcttgcctgcactattaaaggttacgatcttggtactcactttgcgggccgcaacgct
acccaccagatgaagaagctggcccttgaggacctcaagcagttccgcgatcgtcttgaa
attccgatttcggacaaggtgctggaggccgacccctaccgtgctccctacttccatccc
ggagccgatgacgagcgcatccagtacctcatggagcgtcgtcgcgctctcggcggtttc
gtgccggagcgccgtacgaggcacacgccactacccatcccggcgcagaaggccttcgat
ggtgtcaagcgtgggtcgggcaaacaggaggtcgccaccacgatggccttcgtgcgtctg
ctcaaggaccttatgcgcgacaagaatttcgctccgcacgtcgtcccgatcattcctgac
gaggcccgtacctttggcatggactcgttcttcccgacgatcaagatctacaatcctcac
ggccagaactacacccctgtcgaccacgagctcatgctcagctaccgcgaggccaagaac
gggcagatcattcacactggcatcaatgaggctggttcggcggctgctttcattgccgca
ggctcggcatactccactcagggcgtgccgatggtgccgatctacctgttctactcgatg
ttcgggttccagcgtaccggtgattctttctgggcagctggtgatcagatgacgagggga
ttcattattggcgccactgccggacgcaccacgctgaccggtgagggcacccagcacatg
gatggccattcgccggttctggctgcgactaacccagctgtcatctcctacgatccggct
tattcttacgagatctcccacattgttcaggcaggtctggagcacatgtacggcgagaac
gccgaagacgtcatgtactacctgacggtgtacaacgagccgatcgtccagccggctgag
ccagagggcgttgacgccgagggcatcgtcaagggcatgtacctgctctcgaagggctcc
tttgagggcgtcggcgaggatgcccgccgcgttcagctgctggcctccggcgtcgccgtg
ccgtgggccattgaggctcagcagctccttaagggtgactttggcgttgttgccgacgtg
tggtcggtgacgtcgtggaacaacctacgtcgtgacgctatggaggccgaggaacagact
ttcctacaccccgaacagggcaggcgcaccccgtatatcacccaatgcctggccgacgcc
cctggtccagtcgttgcgaccaccgattacacgtgtcaggtgcccgatcagatcgcccag
tgggtgccgggggattatgcctccttaggtgctgacggattcgggttctccgacacccgt
gcggcagcgcgccgattcttccacatcgatggaccgtccatgacagtgcgtgccctccag
atgctcgtcgagcgtggtgaggttcccgaggactggcctgccaaggctgccgagaagtac
gacctcctcaacgtcaacgcgggggcgtccggtaacgctggtggcgacgcctga

DBGET integrated database retrieval system