KEGG   Cutibacterium acnes TypeIA2 P.acn17: TIA2EST22_11575Help
Entry
TIA2EST22_11575   CDS       T01654                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
pav  Cutibacterium acnes TypeIA2 P.acn17
Pathway
pav00473  D-Alanine metabolism
pav00550  Peptidoglycan biosynthesis
pav01100  Metabolic pathways
pav01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:pav00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    TIA2EST22_11575
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    TIA2EST22_11575
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    TIA2EST22_11575
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:pav01011]
    TIA2EST22_11575
Enzymes [BR:pav01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     TIA2EST22_11575
Peptidoglycan biosynthesis and degradation proteins [BR:pav01011]
 Precursor biosynthesis
  Amino acid ligase
   TIA2EST22_11575
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp ATP-grasp_4 ATP-grasp_3 CPSase_L_D2 ATPgrasp_YheCD TTL GARS_A
Motif
Other DBs
NCBI-ProteinID: AEW82599
LinkDB All DBs
Position
2508626..2509573
Genome map
AA seq 315 aa AA seqDB search
MLQPVVVLAGGLSHQRDISLKSGRTVAQALRRVGHEVVEADIDSALIETLRANDGAVVFP
MLHGGLGENGALLEVLQLMGIPYVGSSPATCRISFDKSIASRAVTAAGIVTPQQVALPHD
VFRELGAQTVMRSIAEKFGLPVIVKPARGGSSLGVTKVDGVDDLPQAVANAYAYDDMVVV
EEFIVGTELAIGMITTSEGTRVLPAVEIRPVGGVYDYSAMYTGGETRLTAPADISDTAAQ
TATAMARVVQKELDFSGISRVDAIVDESGRPVFLEAGAAPGMTATSLVPVAMKAAGLDLG
EVCSRLVDDVARNHG
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgttgcaaccagtcgtcgtccttgccggaggactcagccaccagcgcgatatctctctg
aagtcgggtcgcaccgttgcacaagcgctgcggcgggtcggacacgaagtcgtggaagcc
gatattgactccgcactcattgagaccttgcgtgccaacgacggtgccgtcgtgtttccc
atgttgcacggtggtcttggcgaaaatggtgcccttcttgaagtacttcagctcatgggc
atcccctatgtgggctccagtccagcaacctgccgtatctctttcgataagtccatcgca
tctcgcgccgtgaccgcagccgggatcgtcacaccacagcaggtcgcgttaccccatgac
gtcttccgtgagcttggcgctcagacggtcatgcgttcgatcgccgaaaagtttggcctt
ccggtcatcgttaagccggcacgtgggggctcaagcctcggcgtcacaaaagtcgatggc
gtcgacgatcttcctcaggccgtcgcgaacgcctatgcctatgacgacatggttgtagtc
gaggaattcattgtgggcactgagctcgcaataggcatgatcacgacgtctgaaggcacg
cgtgtgctgccagccgtcgagattcgccctgtcggtggtgtttatgattattcagcgatg
tacaccggtggtgagacacgactaacagctcctgcagacattagcgatacagcggcccaa
accgcgacggcgatggcccgagtcgtgcaaaaggagctcgatttctccgggatatctcgt
gtcgatgcgatcgtggacgagtccggtcgcccagttttcttggaggccggtgctgctccc
gggatgacagctacttcgctcgtacccgtggctatgaaagctgccggtctagaccttggc
gaggtgtgctctcgactcgtcgatgacgtcgctcgcaaccatggctga

DBGET integrated database retrieval system