KEGG   Prunus avium (sweet cherry): 110750143
Entry
110750143         CDS       T05161                                 

Definition
(RefSeq) beta-glucosidase 13-like
  KO
K13032  prunasin beta-glucosidase [EC:3.2.1.118]
Organism
pavi  Prunus avium (sweet cherry)
Pathway
pavi00460  Cyanoamino acid metabolism
pavi01100  Metabolic pathways
pavi01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pavi00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    110750143
Enzymes [BR:pavi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.118  prunasin beta-glucosidase
     110750143
SSDB
Motif
Pfam: Glyco_hydro_1
Other DBs
NCBI-GeneID: 110750143
NCBI-ProteinID: XP_021806108
LinkDB
Position
Unknown
AA seq 544 aa
MPLQFRSLLLCVLLLLLGFALANTNAARTDPPVVCATLNRTNFDTLFPGFTFGTATASYQ
LEGAANIDGRGPSIWDAFTHNHPEKITDGSNGDVAIDQYHRYKEDVAIMKDMGLDAYRFS
ISWSRLLPNGTLSGGINKKGIEYYNNLTNELIRNGIEPLVTLFHWDVPQALEEEYGGVLS
PRIVYDFKAYAELCYKEFGDRVKHWTTLNEPYTISNHGYTIGIHAPGRCSSWYDPTCLGG
DSGTEPYLVTHNLLLAHAAAVKLYREKYQASQEGVIGITVVSHWFEPASESQKDINASVR
ALDFMYGWFMDPLTRGDYPQSMRSLVKERLPNFTEEQSKSLIGSYDYIGVNYYSARYASA
YPEDYSIPTPPSYLTDAYVNVTTELNGVPIGPQAASDWLYVYPKGLYDLVLYTKNKYNDP
IMYITENGMDEFNNPKISLEQALNDSNRIDYCYRHLCYLQEAIIEGANVQGYFAWSLLDN
FEWSEGYTVRFGINYVDYDNGLKRHSKLSTHWFKNFLKRSSISKEKIRRCGNNNARARKF
VYRI
NT seq 1635 nt   +upstreamnt  +downstreamnt
atgccattgcaattccgctctttgctcttgtgtgtgctgctgcttctccttggctttgca
ttggcaaataccaatgctgccaggacagatccacccgttgtttgtgcaactctcaacagg
accaatttcgatactctttttccagggttcacatttggcacagctacagcatcttaccaa
ttagaaggtgctgcaaacatagatggtagaggaccaagcatatgggatgccttcacccac
aaccatccagaaaaaatcaccgatggcagtaatggagatgttgctattgatcaatatcac
cgatataaggaagatgtagcaattatgaaggatatggggttggatgcttataggttctct
atctcatggtctagattgttacctaatggaacactaagtggtggaattaacaagaaagga
atcgaatactacaataatctcaccaatgaactcatacgcaatggtatagaaccactagtg
acactctttcattgggatgttccccaagccttagaagaagaatatggtggtgtgttaagc
cctcgtattgtctatgattttaaagcatacgcagaactttgttataaggaatttggtgat
cgagtaaaacattggaccacacttaatgagccatataccattagtaaccatggttataca
atcgggatccacgcaccaggacgatgctcttcttggtatgacccaacctgccttggtgga
gattcgggtactgaaccatatttggtcacacacaacctactccttgctcatgcagctgct
gtaaaattgtacagagaaaaatatcaggcatctcaggaaggagtgataggaataacagtt
gtatcacattggtttgagcccgcttcggagtcacaaaaagatataaatgcttcagttcga
gctttggattttatgtatggatggtttatggacccattgacaagaggtgactatccacag
agcatgcgatctcttgttaaagaacgactaccaaatttcacggaagaacaatccaagtca
ctaattgggtcatatgattatattggagtcaactactattctgctagatatgcaagcgct
taccctgaggattattctatacctacgcctccaagctacctcacagatgcttatgttaat
gttacaacggagcttaatggggtccccattggtccacaggctgcttcagactggttatat
gtttaccctaaaggactttacgatcttgtactctacacaaaaaacaagtacaatgatcca
attatgtacattactgagaatggcatggacgagttcaataatcccaaaatatcccttgag
caagcccttaatgatagcaatagaattgactactgctatcgccacctctgttacctccaa
gaagcaattatagagggtgctaatgtgcagggatactttgcatggtcattgctagacaac
tttgaatggagcgaaggatacactgttcgatttggtatcaactatgttgattacgacaat
ggactgaaaagacactcaaaactctcgacgcactggttcaaaaatttcctcaagagatcc
tcaattagtaaggaaaaaattcgaagatgtggaaacaataatgctagggctcgcaaattt
gtgtatcgaatttga

DBGET integrated database retrieval system