KEGG   Prunus avium (sweet cherry): 110750295Help
Entry
110750295         CDS       T05161                                 

Definition
(RefSeq) peroxisomal fatty acid beta-oxidation multifunctional protein MFP2
  KO
K10527  enoyl-CoA hydratase/3-hydroxyacyl-CoA dehydrogenase [EC:4.2.1.17 1.1.1.35 1.1.1.211]
Organism
pavi  Prunus avium (sweet cherry)
Pathway
pavi00071  Fatty acid degradation
pavi00592  alpha-Linolenic acid metabolism
pavi01100  Metabolic pathways
pavi01110  Biosynthesis of secondary metabolites
pavi01212  Fatty acid metabolism
Module
pavi_M00087  beta-Oxidation
pavi_M00113  Jasmonic acid biosynthesis
Brite
KEGG Orthology (KO) [BR:pavi00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    110750295
   00592 alpha-Linolenic acid metabolism
    110750295
Enzymes [BR:pavi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     110750295
    1.1.1.211  long-chain-3-hydroxyacyl-CoA dehydrogenase
     110750295
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     110750295
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 Pyr_redox_2 RNA_pol_Rpb1_4
Motif
Other DBs
NCBI-GeneID: 110750295
NCBI-ProteinID: XP_021806285
LinkDB All DBs
Position
Unknown
AA seq 725 aa AA seqDB search
MGSRGKGRTVLEVGADGVALITIINPPVNSLSFDVLYSLKDNFEEALRRNDVKAIVLTGA
KGKFSGGFDITAFGGLQGGQKDESKPGFMSVEVITDIFEGTSKPSVAAIDGLALGGGLEV
AMVCNARISTPNAQLGLPELQLGLIPGFGGTQRLPRLVGIAKALEMMLTSKPVKGQEACD
LGLVDAIVSPDQLVSTARQWALDILERRRPWVVTLHKTDKLEPLGEAREMLKFARAQVRK
QAPNLKHPLVCIDVVEEGIASGGRSGLWKEAEAFQALLHSDTSKSLIHIFFAQRGTSKVP
GVTDRGLVPRRVTKVAVIGGGLMGSGIATALILSNYPVILKEVNDKFLQAGIGRVRANLQ
SRVKKGKMTQEKFEKTVSLLKGVLDYESFKDVDIVIEAVIEKVSLKQQIFADLEKYCPQH
CILASNTSTIDLNLIGEKTKSHDRIIGAHFFSPAHVMPLLEIVRTNQTSPQVVVDLLEVG
KKIKKTPVVVGNCTGFAVNRMFFPYTQAGLLLVERGADVYQIDRVITKFGMPMGPFRLAD
LVGFGVAIATGSQFIENFPERTYTSMIIPLMQEDGRAGESTRKGFYTYGDKRKASPDPEL
KKYIEKSRSISGVSIDSKLLKLSEKDIVEMIFFPVVNEACRVLAEGIAVKAADLDIAAVM
GMGFPPYRGGILFWADLLGSKYIYSRLEEWSNIYGEFFKPCAYLAERAAKGASLSAPSKQ
ANSRL
NT seq 2178 nt NT seq  +upstreamnt  +downstreamnt
atgggtagccgcggaaagggtcgtaccgttttggaagtaggagctgatggcgtggctctc
atcaccatcatcaaccctcctgtcaattccctctcttttgatgtattatacagcttgaag
gacaattttgaagaggctttgcgcagaaatgatgtgaaggcaattgttcttacgggtgca
aaaggcaaattttctggtggctttgatattactgcttttggtggactccaagggggacag
aaggacgagtcaaagcctggttttatgtctgtggaagtcatcactgacatttttgaaggt
actagtaaaccttcagttgctgccattgatggccttgcactcgggggaggattggaggtt
gcaatggtgtgcaatgcccgaatatcaactcctaatgcacaattaggcctgcccgaacta
cagcttggacttattcctggattcggagggacgcaacggcttccacgtcttgtgggaatc
gcaaaggcacttgagatgatgctgacatcaaaaccagttaaagggcaagaggcttgtgat
ttaggccttgtcgatgctattgtttcacctgatcagttggtgagcaccgcacgccagtgg
gccttggatatcttggagcgtagaagaccgtgggttgttactcttcacaagactgacaag
ttagagccccttggagaagctagggaaatgcttaaatttgcaagagctcaagtcaggaag
caggctccaaatctcaaacacccattggtttgcattgatgttgttgaagagggtatagcc
tctggtggccggtctggactttggaaggaggctgaggcttttcaagcacttctgcattct
gacacttccaagagtttgatccatatcttctttgctcaacggggaacatcaaaggtacct
ggggtgactgatcgtggtttggtgcctagacgagtaactaaggttgctgtcattggtgga
ggattaatggggtctggaatagctacagcattgattcttagtaattatccagtgatcctg
aaagaagtaaatgataagttcttgcaggctgggattggtagagtcagagccaatctacag
agccgtgtcaagaaaggaaaaatgactcaagaaaagtttgaaaagaccgtctctcttctt
aagggtgtcctggattatgaaagctttaaagatgtggacattgtcatagaggcggttatt
gagaaggtttctctaaagcaacaaatttttgctgatcttgaaaaatattgcccacaacac
tgcatacttgcaagtaatacttccacaatcgacttgaacctcattggagagaagacgaag
tctcatgatcggattattggcgcccatttctttagtcccgctcatgtcatgccacttttg
gaaattgttcgtactaatcagacgtctccccaagttgttgtcgatttgctagaagttggg
aaaaagataaagaaaaccccagttgttgttggaaactgcacaggatttgctgtaaacaga
atgttctttccttatacacaagctggtcttttgcttgttgaacgtggtgctgacgtctat
cagattgatagagtaatcaccaagtttggaatgcctatgggcccattcagattggctgat
ctggttggctttggtgtcgctattgcaactggttcgcaatttattgagaattttcctgag
aggacatatacatcaatgattatccctctgatgcaggaggatggaagagcaggtgaaagt
actcgaaaagggttctatacttatggtgataaacgcaaagctagcccagatcctgaattg
aaaaaatatattgagaagtcaaggagcatttctggtgtttcaatagattctaagctattg
aagctatcagaaaaggacattgtggagatgatatttttccctgttgtgaatgaggcctgt
cgagtgcttgctgaaggtattgctgtaaaagctgctgaccttgacattgctgcagtcatg
ggcatgggtttcccaccttacaggggaggtatcttgttctgggctgatttacttggatcc
aaatacatatattcaagactggaggaatggtcaaatatttatggtgaatttttcaagcct
tgtgcctatttggctgaaagagctgcaaagggggcttctctgagtgctccgtcgaagcaa
gcaaattctcggttataa

DBGET integrated database retrieval system