KEGG   Prunus avium (sweet cherry): 110753220Help
Entry
110753220         CDS       T05161                                 

Definition
(RefSeq) aldehyde dehydrogenase family 2 member B7, mitochondrial
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
pavi  Prunus avium (sweet cherry)
Pathway
pavi00010  Glycolysis / Gluconeogenesis
pavi00053  Ascorbate and aldarate metabolism
pavi00071  Fatty acid degradation
pavi00280  Valine, leucine and isoleucine degradation
pavi00310  Lysine degradation
pavi00330  Arginine and proline metabolism
pavi00340  Histidine metabolism
pavi00380  Tryptophan metabolism
pavi00410  beta-Alanine metabolism
pavi00561  Glycerolipid metabolism
pavi00620  Pyruvate metabolism
pavi00903  Limonene and pinene degradation
pavi01100  Metabolic pathways
pavi01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pavi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    110753220
   00053 Ascorbate and aldarate metabolism
    110753220
   00620 Pyruvate metabolism
    110753220
  09103 Lipid metabolism
   00071 Fatty acid degradation
    110753220
   00561 Glycerolipid metabolism
    110753220
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    110753220
   00310 Lysine degradation
    110753220
   00330 Arginine and proline metabolism
    110753220
   00340 Histidine metabolism
    110753220
   00380 Tryptophan metabolism
    110753220
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    110753220
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    110753220
Enzymes [BR:pavi01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     110753220
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh AAA_25
Motif
Other DBs
NCBI-GeneID: 110753220
NCBI-ProteinID: XP_021809761
LinkDB All DBs
Position
Unknown
AA seq 534 aa AA seqDB search
MASRRVSSVLSRSFTSASLFSAGRSSSVARGIGKYSTDASIEAPIIPSVKVNYTQLLING
QFVDAASGKTFPTLDPRTGNVIAHVAEGDSEDINRAVSAARKAFDEGPWPKMTAYERSRV
LFRFADLVEKHNDEIAALETWDNGKPFEQAAKIEVPMLVRFFRYYAGFADKIHGLTVPAD
GEYHVQTLHEPIGVAGQIIPWNFPLLMFAWKVAPALACGNTVVLKTAELTPLSALYVATL
LQEAGLPPGVLNVVSGFGPTAGAALCSHMEVDKVAFTGSTDTGKKVLELAAKSNLKIVTL
ELGGKSPFIVCEDADVDKAVELAHFAVFFNTGQCCCSGSRTFVHERVYDEFIEKAKARAE
KRIVGDPFKEGVEQGPQIDSDQFQKILKYIDYGIKSGATLETGGGRLGTKGFYIKPTVFS
NVKDDMPIAQDEIFGPVQSILKYKDLDEVIRRANATRYGLAAGVFTQNIDTANTLTRALR
VGSVWINCFDIFDAAIPFGGYKMSGHGREKGIYGLSNYLQVKAVVTPLKNPAWL
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
atggcgtctcggagggtctcttcggttctgtctcgttcattcacttctgcttctctgttt
tctgcagggaggtcttcttctgtggctagaggaattggtaaatatagcactgatgcttca
attgaggcaccaatcattccatccgttaaagtaaattatactcagcttctaattaatgga
caatttgtagatgcagcgtcagggaaaacttttcccacattggacccccgaactgggaat
gtgattgctcatgttgctgaaggcgattctgaagatataaatcgggcagtttctgctgcc
cgcaaggcctttgatgaaggaccatggccaaagatgacagcttatgaaagatcaagggtc
cttttccgctttgctgatttggttgaaaagcataatgatgaaattgcagcccttgagact
tgggataatgggaagccatttgaacaggctgctaaaattgaagtaccaatgcttgtgcgt
tttttccggtactatgctggatttgcggataagattcatggtctcacagttccagctgat
ggagagtatcatgtgcaaaccttgcatgaacctataggtgttgcaggtcagataattcca
tggaatttccctcttctcatgtttgcttggaaggttgcgcctgccttagcatgtggcaac
accgttgttctgaagacagcagagctgacaccattgtctgctctatatgtagcaacgctg
ttgcaggaggctggacttcctccaggtgttttaaatgtggtttcaggttttggtcccact
gccggtgcagcgctttgtagtcatatggaagttgataaggttgcttttactggatcaact
gataccggcaaaaaagtactagaattggctgctaaaagcaatcttaagattgtaactttg
gagcttggcgggaaatccccatttattgtatgtgaggatgctgatgtagataaggctgtt
gagctggcacactttgctgtattctttaatacgggtcaatgctgctgttctggttcgcgt
acatttgtacatgaaagagtatatgatgagttcatagagaaagcaaaggcccgtgctgag
aaacgcattgttggggatccattcaaggagggtgttgagcaaggtcctcagattgattca
gaccaatttcagaagatcctgaagtacatagattatggtattaaaagtggagctacactg
gaaactggaggagggaggcttggcacaaagggtttctatattaagcccactgtattctca
aatgttaaggatgacatgccaatagcacaggatgagatttttggtccagtgcagtccatc
ttgaaatacaaggaccttgatgaggtgataagaagggcaaatgctacgcgatacgggctt
gctgcaggggtcttcacacaaaacatagatactgcaaacacattgacacgtgcattgcgg
gtcggtagtgtatggataaactgctttgatatctttgatgctgcaattccttttggaggg
tacaagatgagtggacacggaagagaaaagggcatttacggtctttcgaattacttgcaa
gttaaggctgttgtcacgcccctgaaaaatcctgcatggctataa

DBGET integrated database retrieval system