KEGG   Prunus avium (sweet cherry): 110755298Help
Entry
110755298         CDS       T05161                                 

Definition
(RefSeq) DNA ligase 1
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
pavi  Prunus avium (sweet cherry)
Pathway
pavi03030  DNA replication
pavi03410  Base excision repair
pavi03420  Nucleotide excision repair
pavi03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:pavi00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    110755298
   03410 Base excision repair
    110755298
   03420 Nucleotide excision repair
    110755298
   03430 Mismatch repair
    110755298
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:pavi03032]
    110755298
   03400 DNA repair and recombination proteins [BR:pavi03400]
    110755298
Enzymes [BR:pavi01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     110755298
    6.5.1.6  DNA ligase (ATP or NAD+)
     110755298
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     110755298
DNA replication proteins [BR:pavi03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    110755298
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     110755298
DNA repair and recombination proteins [BR:pavi03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     110755298
   NER (nucleotide excision repair)
    Other NER factors
     110755298
   MMR (mismatch exicision repair)
    Other MMR factors
     110755298
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C RNA_ligase
Motif
Other DBs
NCBI-GeneID: 110755298
NCBI-ProteinID: XP_021812172
LinkDB All DBs
Position
Unknown
AA seq 789 aa AA seqDB search
MLSRSLCSCYCLRPRSLHHLSTSISVFRSKPSSLSLTLISLSPKNPNLRAMSSRPSAFDA
LMSGARAAAAKKKPQASPPKKRKTLEPNPIENPQLLLKPENGSPTQAPESKEVKEALESS
SNGGQVVPPAKKVCAAAGAQERTAELKNRIALLKKKAGEFDPKLMANWGEGERVPFAFVC
LAFDLIANETGRIVITDIVCNMLRTVMHTTPEDLVPVVYLAANRIAPAHEGLELGIGDAS
IIKALAEACGRTEAHVKKQYKELGDLGLVAKASRSSQSMMRKPDSLTVTKVFSTFRQLAK
ESGKDSQEKKKNHIKALLVAATDCEPQYLIRLLQTKLRIGLAEQTLLAALGQAAVHTEKH
STPPSHIQSPIDEAAKIVKQVYSLLPDYDKIIPALLSGGVWNLPKTCSFTLGVPVGPMLA
KPTKGVSEIVQKFQDTEYTCEYKYDGERAQIHYMEDGSVEIYSRNAERNTGKFPDVVVAV
SRLKKSSVTSFVLDCELVAYDRVKQKILPFQVLSTRARKNVAMSDIKVDVCIFAFDMLYL
NGQPLIQEQLKVRRESLYDSFVEEAGFFQFATAITSNDIEEIQKFLDAAVDSSSEGLIIK
TLNKDATYEPSKRSLNWLKLKKDYMESIGDSLDLVPIAAFHGRGKRTGVYGAFLLACYDS
NNEEFQSICKIGTGFSEAMLEERSASLRTKVIPKPKSYYRYAETMNPDVWFDASEVWEVK
AADLTISPVHRAAVGIVDPNKGISLRFPRLVRVREDKPPEQASSSAQVAEMYSAQANTRS
NNQDDNEDD
NT seq 2370 nt NT seq  +upstreamnt  +downstreamnt
atgctctcccgatcactgtgttcatgctattgtctacgcccacgctctctccaccatctc
agcacctccatttctgtcttccgctccaaaccctcttctctctctctcaccctcatttcc
ctctccccgaaaaaccctaatcttcgcgccatgtcctctcgcccctccgccttcgacgct
cttatgtccggcgctcgcgccgccgcagccaagaaaaagccccaagcttcaccccccaag
aagcgaaaaaccctagaacctaaccctattgaaaacccccaattgctattgaaacccgaa
aatggcagtccaacccaagccccagaatccaaggaagtcaaagaagctctagaaagttct
agtaatggcggccaggtggttccccccgcgaaaaaagtgtgcgcggcggcaggtgctcag
gagcggacggcggaattgaagaaccgaatcgctctgttgaagaagaaagccggtgaattt
gacccgaaattgatggcgaattggggcgagggcgagagggttccgtttgcgtttgtttgt
ttggcttttgatttgattgcgaacgagacgggtcggattgtgatcacggatatagtgtgt
aacatgttgaggactgtaatgcacaccacgcctgaggatttggtgcccgtggtttatctg
gccgccaatcggattgctccggcgcatgagggattggagcttggaattggggatgcttcg
attatcaaggcacttgcagaggcttgtgggaggactgaagcacatgttaagaaacaatac
aaggaattgggagatttgggtcttgttgcaaaagcaagccgttcatctcaatctatgatg
cgcaagcctgattcgttaactgtcaccaaggttttcagtacatttcgtcaacttgctaag
gaatctgggaaggatagtcaggagaagaaaaagaaccatatcaaggcacttcttgttgct
gccactgattgtgaacctcaatatctgatccgtttgcttcagacaaagctgcgaattggg
ttggcagagcagactctcttagctgcattgggacaagctgcagtgcatactgaaaaacat
tcgacaccaccttctcatattcagagtcctatagatgaggctgcaaagattgttaagcaa
gtgtactctctacttcctgattacgataaaatcatccctgcccttttaagtggtggtgtg
tggaatcttccgaagacatgtagctttactttgggtgtcccagttggacctatgctagca
aagccaactaaaggtgtatctgagattgtacagaagtttcaggatacagaatacacctgt
gaatacaagtatgatggagaacgtgcccagatacattacatggaggatggttctgttgag
atatacagtcgaaatgctgaacgaaacactggaaagttccctgatgttgttgttgcagtg
tcgaggttaaagaagtcatctgtaacatcatttgttctggattgtgaattggttgcttat
gaccgtgtaaaacagaaaattcttcctttccaggtactcagcactagagctcgtaaaaat
gtggcaatgagtgatattaaggtcgatgtctgcatatttgcttttgacatgttgtatctt
aatggacaaccactaattcaagaacaactgaaagttcgtagagagagtctttatgactct
tttgtggaagaagctggattttttcagtttgccacagcaataacatcaaatgatattgaa
gaaatacaaaagtttcttgatgctgctgttgattcaagttctgagggtttaattatcaaa
acattgaacaaagatgctacttatgagccttcaaagcggtcacttaactggctgaaattg
aagaaagattacatggagagtattggggactcactagacttggtacctattgctgctttc
catggccgggggaaacgtacaggtgtctacggtgctttcctccttgcttgttatgatagc
aacaatgaagagtttcaaagcatttgtaaaataggcactggattctctgaagcaatgctt
gaagaacgttctgccagtctccgtactaaagtgatacccaaacctaagtcatactatcgt
tatgcagagacaatgaatcctgatgtatggtttgatgcctctgaggtttgggaagtgaaa
gctgcggacttgactattagccctgttcatcgtgccgcagttggcatagtagatcctaat
aagggtatttctcttcgatttccacgtcttgttcgtgttcgggaagataaacccccagag
caagcctcatcatctgcgcaggttgctgagatgtattctgcccaagctaacactcgttca
aacaatcaagatgacaacgaagatgattaa

DBGET integrated database retrieval system