KEGG   Prunus avium (sweet cherry): 110757160Help
Entry
110757160         CDS       T05161                                 

Definition
(RefSeq) dihydrolipoyllysine-residue acetyltransferase component 4 of pyruvate dehydrogenase complex, chloroplastic
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
pavi  Prunus avium (sweet cherry)
Pathway
pavi00010  Glycolysis / Gluconeogenesis
pavi00020  Citrate cycle (TCA cycle)
pavi00620  Pyruvate metabolism
pavi01100  Metabolic pathways
pavi01110  Biosynthesis of secondary metabolites
pavi01200  Carbon metabolism
Module
pavi_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:pavi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    110757160
   00020 Citrate cycle (TCA cycle)
    110757160
   00620 Pyruvate metabolism
    110757160
Enzymes [BR:pavi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     110757160
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding
Motif
Other DBs
NCBI-GeneID: 110757160
NCBI-ProteinID: XP_021814407
LinkDB All DBs
Position
Unknown
AA seq 484 aa AA seqDB search
MASSPFLSKTTISFSSSISTSLPWRSSHSSPSFSTAFRTKPRRRTLTVQSKIREIFMPAL
SSTMTEGKIVSWVKSEGDVLSKGESVVVVESDKADMDVETFYDGILAAIVVGEGETAPVG
AAIGLLAETEEEVPEAKAKAKSASSDSPASSSPAAEAVTPTPPPATSTPAPAIAQPSPPA
TYTPKKTVATPFAKKLAKQHKVDIASVVGSGPFGRITPADVEAAAGIAQPKKTVAAEPTP
VSAAPPKPSAAPSASSAPLLPGSTVVPFTTMQAAVSKNMLESLSVPTFRVGYPISTDALD
ALYEKVKPKGVTMTALLAKAAALALAQHPVVNASCKDGKSFTYNSSINIAVAVAINGGLI
TPVLQDADKLDLYLLSQKWKELVEKARAKQLQPHEYSSGTFTLSNLGMFGVDRFDAILPP
GQGAIMAVGASKPTVVADADGFFSVKSKMLVNVTADHRIVYGADLAAFLKTFAKIVENPE
SLTL
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcttctccatttctatcgaagaccaccatttccttctcctcctccatctccact
tctcttccctggcggtcctcacactcttccccttccttctccaccgcatttcgcactaaa
ccccgtcggagaaccctgaccgtccaatccaagatcagggagatcttcatgcctgccctc
agctccaccatgaccgagggaaagatcgtctcctgggtcaaatccgaaggcgacgtcctc
tccaaaggcgagagcgtcgtcgtcgtcgagtccgacaaggccgacatggacgtcgagacc
ttctacgacggaattctcgccgccatcgtcgtcggcgagggcgagaccgcccctgtcgga
gccgccatcggactactggccgagaccgaagaggaagtccccgaggctaaagccaaagcc
aaatccgcttcatcagattcccccgcttcttcttccccggctgctgaagctgttacgccc
actcctcctcctgctacttccactcccgctccagcaatcgcccagccttctccacctgct
acttacactcccaaaaagactgtggccacgccttttgccaaaaagctagccaagcaacac
aaggtggacattgcctccgtggtgggctccggcccatttggccgaattacacctgctgat
gtggaggccgccgccggaattgcccagcccaagaaaaccgtcgccgccgagcccactccc
gtgtccgctgctccacccaagccttctgctgctccttcggcttcatcagcgcctctgctt
cctggctcaacggtggttcccttcacaacgatgcaggccgccgtttcgaagaacatgttg
gagagtctctcggtgccaacattccgcgttggttatccaatcagcaccgacgcgctcgat
gccctctacgagaaggtgaagccaaagggtgtgaccatgactgcattgttggccaaggct
gctgctctggcactcgctcagcacccggttgtaaatgccagctgcaaagacggaaagagc
ttcacgtataatagtagcataaacatcgccgttgctgtggcaatcaacggtggccttata
acccctgttcttcaggatgccgataagttggatttgtatttgttatcccagaaatggaaa
gagctagtggagaaggcccgtgctaagcaacttcagccccatgagtacagttcaggaact
ttcactttgtccaatttgggcatgtttggagtggacagatttgatgctattcttcctcca
ggacagggggctatcatggctgttggagcttcaaagccaactgttgtggctgatgcagat
gggttcttcagtgtaaaaagtaaaatgctggtaaatgtaacagctgatcaccggattgtt
tatggtgctgatttggctgccttcctcaagacatttgcaaagattgttgagaacccagag
agcctcacattgtag

DBGET integrated database retrieval system