KEGG   Prunus avium (sweet cherry): 110759755Help
Entry
110759755         CDS       T05161                                 

Definition
(RefSeq) superoxide dismutase [Cu-Zn] 1
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
pavi  Prunus avium (sweet cherry)
Pathway
pavi04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:pavi00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    110759755
Enzymes [BR:pavi01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     110759755
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-GeneID: 110759755
NCBI-ProteinID: XP_021817567
LinkDB All DBs
Position
Unknown
AA seq 152 aa AA seqDB search
MVKGVAVLGSSEDVKGIINFTQEGDGPTTVTGSISGLKPGLHGFHVHEFGDTTNGCLSTG
PHFNPDGKHHGSPEDEIRHSGDLGNITVGDDGTANFTIIDKQIPLTGPQSIIGRAVVVHA
DPDDLGQGGHELSKSTGNAGGRVACGIIGLQN
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
atggtgaaaggcgttgctgttcttggctccagtgaggatgttaaaggaatcatcaacttc
acccaggagggagatggcccaacgactgtgactggaagtatttctggcctcaagcctggg
cttcatggtttccatgtccatgaatttggagacacaaccaacggttgcttgtcaactgga
ccacatttcaatcctgatggcaagcaccatggttcccctgaagacgagattcgccattcc
ggtgatcttggaaatatcactgttggggacgatggaactgcaaacttcacaattattgac
aagcagattcctctgacaggaccacaatcaatcattggtagggcggttgttgtccatgca
gaccccgatgacctgggccagggtggacatgagcttagcaaaagcactggaaatgctggt
ggcagggttgcttgtggtattattggtctccaaaactga

DBGET integrated database retrieval system