KEGG   Prunus avium (sweet cherry): 110764337Help
Entry
110764337         CDS       T05161                                 

Definition
(RefSeq) phosphoenolpyruvate carboxylase 2
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
pavi  Prunus avium (sweet cherry)
Pathway
pavi00620  Pyruvate metabolism
pavi00710  Carbon fixation in photosynthetic organisms
pavi01100  Metabolic pathways
pavi01200  Carbon metabolism
Module
pavi_M00168  CAM (Crassulacean acid metabolism), dark
pavi_M00170  C4-dicarboxylic acid cycle, phosphoenolpyruvate carboxykinase type
pavi_M00171  C4-dicarboxylic acid cycle, NAD - malic enzyme type
pavi_M00172  C4-dicarboxylic acid cycle, NADP - malic enzyme type
Brite
KEGG Orthology (KO) [BR:pavi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    110764337
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    110764337
Enzymes [BR:pavi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     110764337
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PEPcase PEPcase_2 WbqC
Motif
Other DBs
NCBI-GeneID: 110764337
NCBI-ProteinID: XP_021822978
LinkDB All DBs
Position
Unknown
AA seq 966 aa AA seqDB search
MASRNLEKMASIDAQLRLLAPGKVSEDDKLIEYDALLLDRFLDILQDLHGESLRETVQEC
YELSAEYERKQDPKKLEELGKVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRIK
LKKGDFADEASATTESDIEETLKRLVGDLKKSPEEVFDALKNQTVDLVLTAHPTQSVRRS
LLQKHARVRNCLTQLYAKDITPDDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAGM
SYFHETIWKGVPKFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTR
DVCLLARMMAANLYFSQIEDLMFELSMWRCNDELLSRAHELHRSSKKDAKHYIEFWKQIP
PNEPYRVILGDVRDKLYSTRERARQLLANGISEIPEETTFTNVEQFLEPLEMCYRSLCSC
GDRAIADGSLLDFLRQVSTFGLSLVRLDIRQESDRHTDVLDAITRHLEIGSYREWSEERR
QEWLLSELSGKRPLFGSDVPKTEEIADVLDTFHVISELPSDNFGAYIISMATAPSDVLAV
ELLQRECGVKKPLRVVPLFEKLADLEAAPAAVGRLFSIDWYKNRINGKQEVMIGYSDSGK
DAGRLSAAWQLYKAQEELIKVAKQYGVKLTMFHGRGGTVGRGGGPTHLAILSQPPDTIHG
SLRVTVQGEVIEQSFGEEHLCFRTLQRFTAATLEHGMHPPVSPKPEWRALMDEMAVLATK
EYRSIVFQEPRFVEYFRRATPELEYGRMNIGSRPSKRKPSGGIESLRAIPWIFAWTQTRF
HLPVWLGFGAAFKQAIDKDAKHLHMLREMYNQWPFFRVTIDLIEMVFAKGDPGIASLYDK
LLVSEDLWSFGERLRANYEETKSLVLQVAGHRALLEGDPYLRQRLLLRDSYITTLNVCQA
YTLKQIRDPNYHVKVRPHLSKEYMEKTSKPAAELVNLNPTSEYAPGLEDTLILTMKGIAA
GMQNTG
NT seq 2901 nt NT seq  +upstreamnt  +downstreamnt
atggcttcaaggaacttagagaagatggcttcaattgacgcacagctgaggctgctggca
ccagggaaggtgtctgaggatgacaaactgattgagtatgatgctttgttattggatcgc
ttccttgacattcttcaggatttacatggagagagtctcagagaaacggtgcaagagtgt
tatgaactttccgcagaatatgaaagaaagcaggaccctaaaaagttggaggaacttggg
aaggttctaacgagtttggatcctggggactcgattgtcattgctaagtccttttctcac
atgcttaacttggccaatttggccgaggaagttcagattgcttatcgaaggaggatcaag
ttgaagaagggagacttcgctgatgaggcttcagctactacagagtcagacattgaagag
actctcaagaggcttgtgggagacctgaagaagtccccggaagaagtttttgatgccttg
aagaaccagactgtagatttggtcctaacggcacatcctactcagtctgttcgaagatcc
ttgcttcaaaagcatgcaagggtaagaaattgtttgacacagttgtatgctaaggacatt
acacctgatgataaacaggaactcgatgaggctctacaaagggagattcaagctgcattt
cgtacagatgaaatccgaaggactcctccaacccctcaagatgagatgagggcgggaatg
agctactttcatgagacaatttggaaaggtgtaccaaaattcttacgtcgtgttgacact
gctttgaagaacatagggataaatgaacgtgttccttacaatgcccctctcattcagttt
tcttcttggatgggtggggaccgtgatggaaaccccagggtcactcctgaagttacacgg
gatgtatgtttgttggctagaatgatggctgctaacttgtacttctcccagatagaggat
cttatgtttgagttatctatgtggcgctgcaatgatgagcttctttctcgtgctcatgaa
ctacataggtcttcaaagaaggatgcaaaacactatatagagttttggaagcaaattcct
ccaaatgagccttatcgcgttattcttggtgatgtaagagacaagctgtacagtacacgt
gaacgtgctcgccaattgttagccaatggaatctctgaaattcctgaggaaacaaccttt
acaaatgttgaacagttcctggagccgctcgaaatgtgttaccggtcactctgctcctgt
ggcgatcgggcaattgctgatggaagccttcttgatttcttacggcaagtttccactttt
gggctctctcttgtgagactagacatacggcaagaatcagacaggcacactgatgtcctc
gatgctataacaaggcacctggagattgggtcttatcgagaatggtccgaggaacgtaga
caagaatggctcttgtctgagcttagtggcaagcgccccctttttggctctgatgttccc
aagactgaagaaattgctgatgtgctggacacattccatgtcatttcagaacttccctca
gacaattttggtgcttatattatctcaatggcgacagcgccatctgatgtgcttgctgtg
gagcttttgcaacgtgaatgtggtgtgaagaaaccactaagggttgtcccattgtttgag
aagcttgctgatcttgaggctgctcctgctgccgtgggccgtctcttttcaatagattgg
tacaaaaacaggatcaatgggaagcaagaagtcatgataggatactcagattcaggaaag
gatgctggccggctctctgcagcatggcagttatacaaggctcaagaagagctcataaag
gttgcgaaacaatatggggttaagcttacaatgtttcacggtcgaggtggaacagttgga
agaggaggggggcccacccatcttgctatattgtctcagccacctgacacaattcatggt
tcacttcgtgttacagttcaaggtgaagttattgaacaatcatttggggaggagcacttg
tgctttagaacactccagcgtttcacagcagctacacttgagcatggaatgcatcctcct
gtctcaccaaagcccgaatggcgtgcactaatggatgagatggctgtccttgcaacaaag
gaataccgttcaatagttttccaggaacctcgttttgttgaatactttcgccgtgcaaca
ccagagttggagtatggccggatgaacattgggagtcgtccttcaaaacgaaagccaagt
ggaggcattgaatcactacgtgcaatcccatggatatttgcttggacccaaacaagattt
catttaccagtgtggcttgggtttggggcagcatttaagcaagctattgataaggatgcg
aaacatctccatatgcttcgagagatgtataatcagtggcctttcttcagagtcacgatt
gatttaattgagatggtgtttgccaagggcgacccgggtattgcctctctgtatgacaag
cttcttgtgtcagaagacctatggtcatttggagagagattgagggccaactatgaagaa
actaagagcctcgtcctccaggttgctggacatagagctcttctggaaggagatccttat
ttgaggcagagactcctcctccgtgactcttacatcaccacacttaatgtgtgccaagcc
tatacactgaagcagattcgtgatccgaactaccatgttaaagtaaggccacacttgtca
aaggagtacatggaaaaaacaagcaagccagcggcagagcttgtaaatcttaatccaacg
agcgagtatgctcctggactagaagacacacttattttgaccatgaagggtattgctgct
ggcatgcagaataccggctga

DBGET integrated database retrieval system