KEGG   Prunus avium (sweet cherry): 110764648
Entry
110764648         CDS       T05161                                 

Definition
(RefSeq) beta-glucosidase 12-like
  KO
K13032  prunasin beta-glucosidase [EC:3.2.1.118]
Organism
pavi  Prunus avium (sweet cherry)
Pathway
pavi00460  Cyanoamino acid metabolism
pavi01100  Metabolic pathways
pavi01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pavi00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    110764648
Enzymes [BR:pavi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.118  prunasin beta-glucosidase
     110764648
SSDB
Motif
Pfam: Glyco_hydro_1
Other DBs
NCBI-GeneID: 110764648
NCBI-ProteinID: XP_021823348
LinkDB
Position
Unknown
AA seq 509 aa
ATLNRTHFDTLFPGFTFGAATAAYQLEGAANIDGRGPSVWDNFTHEHPEKITDGSNGDVA
IDQYHRYKEDVAIMKDMGLDAYRFSISWSRLLPNGTLSGGINKKGIEYYNNLTNELLRNG
IEPLVTLFHWDVPQALVDEYGGLLSPRIVDDFKAYANLCYKEFGDRVKHWTTLNEPYTVS
NHGYTIGIHAPGRCSDWYNPKCLGGDSGTEPYLVTHHLLLSHAAAVQLYREKYQASQNGF
IGITIVSHWFEPASESQEDKDAAFRALDFMYGWFMDPLTRGDYPQTMRSLVGTRLPNFTE
EQSKSLSGSYDYIGVNYYSARYASAYPKGYSVSTPPSYATDVYVNVSTDLNGVPIGPRAA
SDWLYVYPKGLYDLVLYTKEKYNDPIMYITENGMDEFNNPKLSLEQALDDANRIDYYYRH
LCYLQAAIKEGANVQGYFAWSLLDNFEWSEGYTVRFGINYIDYDNGLERHSKLSTHWFKS
FLKRSSISKKKIRRCGNNNTRATKFVYQI
NT seq 1530 nt   +upstreamnt  +downstreamnt
gcaactctcaacaggacccatttcgatactctttttccagggttcacatttggcgcagct
acagcagcttaccaattagaaggtgctgcaaacatagacgggagaggaccaagcgtatgg
gacaacttcacccatgagcatccagaaaagataactgatggtagcaatggagatgttgct
attgatcaatatcaccgctataaggaagatgtggcaattatgaaggatatggggttggat
gcttatagattctctatctcatggtccagattgttaccgaatggcacactaagtggtgga
attaacaagaaaggaatcgaatactacaataatctcaccaatgaactcctacgcaatggt
atagagccattagtgacactcttccattgggatgttccccaagccttagtagacgaatat
ggtggtttgttaagccctcgcattgtcgatgactttaaagcatacgcaaacctttgttac
aaggaatttggtgatcgagtaaagcattggaccacacttaatgagccatataccgttagt
aaccatggttacacaatcgggatccacgcacctggacgatgctctgattggtataaccca
aaatgccttggtggagattcgggtactgaaccatatttggtgacacaccacttactcctt
tctcatgcagctgctgtacaattgtaccgagaaaaatatcaggcaagtcaaaatggtttc
ataggaataacaattgtatcacattggtttgagcccgcttcggagtcacaagaagataaa
gacgctgcatttcgagctttggattttatgtatggatggtttatggacccattgacaaga
ggtgactacccgcaaaccatgcgatctttagttggcacacgattaccgaatttcacagaa
gaacaatccaagtcactgagtgggtcatatgactacattggagtaaactactattctgcg
agatatgcaagcgcttatcctaagggttattctgtatctacacctccaagctacgcgaca
gatgtttatgttaatgtttcaactgatcttaatggggtccccattggtccacgggctgct
tcagactggttatatgtttacccaaaaggactttacgatcttgtactctacacaaaggaa
aagtataatgatccaattatgtacattactgagaatggcatggatgagttcaataatccc
aaattatcacttgagcaagcccttgatgatgctaatagaattgactactactatcgccac
ctttgttacctccaagcagcaattaaggagggtgctaatgtgcagggatactttgcatgg
tctttgctagacaactttgaatggagcgaaggatacactgttcggtttggtatcaactat
attgattacgacaatggactggaaagacactcaaaactctcgacgcactggttcaaaagt
ttcctcaagagatcctcaattagtaagaaaaaaattcgaagatgtgggaacaataatact
agggctaccaaatttgtgtatcaaatttga

DBGET integrated database retrieval system