KEGG   Prunus avium (sweet cherry): 110764926Help
Entry
110764926         CDS       T05161                                 

Definition
(RefSeq) alpha-glucosidase-like
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
pavi  Prunus avium (sweet cherry)
Pathway
pavi00052  Galactose metabolism
pavi00500  Starch and sucrose metabolism
pavi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pavi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    110764926
   00500 Starch and sucrose metabolism
    110764926
Enzymes [BR:pavi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     110764926
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2
Motif
Other DBs
NCBI-GeneID: 110764926
NCBI-ProteinID: XP_021823668
LinkDB All DBs
Position
Unknown
AA seq 906 aa AA seqDB search
MKMRRSRPNKPKPIYHLPLFFFFFSAVFHCGLVSSSNTTGAKEAAVAGFGYKIHSVNYDS
SGNSLTANLGLIKKSSLYGPDIPNLNLHASYETKDRLRIRITDSTHQRWEIPRQIIPRQT
TSQHSQQCQTHNKHLLISNDLVFTLHNTTPFGFTVTRQSSNDVIFDASPNPSNPNTFLVF
KDQYIQLSSSLPKARSSLFGLGEHTKSSFKLTPNQTLTLWTADIGSANADVNLYGSHPFY
LDVRSASPDGKADSAGTSHGVLLLNSNGMDITYGGDRITYKAIGGIVDLYFFSGPTPELV
VEQYTELIGRPAPMPYWSFGFHQCRYGYKNVSDLEGVVAGYAKAAIPLEVMWTDIDYMDA
YKDFTLDPINFPLDKMKKFVNTLHQNDQKYVLILDPGISVNKSYGTYNRGLKADIFIKRD
GIPYLGSVWPGPVYFPDFAHPQSEKFWANEIKIFQDALPFDGLWLDMNELSNFITSPPTP
SSTLDDPPYKINNAGVLRPINNNTVPASALHFGNITEYGAHNLYGLLESRATNKALVSVT
GKRPFILSRSTFVSSGTYTAHWTGDNSAEWSDLAYTIPAILNFGLFGVPMVGADICGFSG
NTTEELCRRWIQLGAFYPFARDHSEKFTIRQELYLWDSVAATARKVLGLRYRLLPLFYTS
MYEAHKKGTPIARPLFFSFPQDIRTYEINTQFLIGRGVMVSPVLKPGVSSVDAYFPAGNW
FDLFNYSNSVSVKSGEHVTLDAPPDHINVHVREGNILALQGKALTTEAARKTAFELLVVS
SSNGQSTGEVFLDDGEEVEMGGKGGKWSLVRFYCATENGSVSVRSTVVNGGFALSQKWII
DKVTIIGLDNVDGLEGYALNITKGANLKGGHSDIRASFGINKRFVLVEISRLSILIGADF
NLELKY
NT seq 2721 nt NT seq  +upstreamnt  +downstreamnt
atgaagatgcgaagaagcagaccaaacaaaccaaaaccaatatatcatcttccactcttc
ttcttcttcttctctgctgtgtttcactgtggtttagtttcatcatcaaataccacggga
gccaaagaagctgcagttgctgggtttggatataaaattcattcagtcaactatgattct
tctgggaactcattgactgctaatcttggcctcatcaagaaatcctccctctacggacct
gacatcccaaatctcaaccttcacgccagctatgaaaccaaagatcggctaagaattcga
ataacagactcaacgcaccaaagatgggaaatcccacgacaaataatcccccgccaaaca
acttcacagcattcacaacaatgtcaaacccacaacaaacacctcctgatctccaacgac
cttgtcttcactctccacaacaccaccccatttggcttcaccgtcacccgccaatcctcc
aacgatgtcattttcgacgcctccccgaacccatcaaaccccaacaccttcttggtcttc
aaggaccaatacatccagctctcctcctccctccccaaagccaggtcctcccttttcggc
ctcggtgagcacaccaagtcctccttcaagctcacccctaaccagaccttgacactctgg
acagctgacattggcagcgccaatgctgacgtcaacctctacgggtcccaccccttctac
ctggacgtcaggtcagcttctccagatggcaaggccgacagcgctggaacatctcatgga
gtgttgctgctgaatagcaatggcatggacataacatacggcggtgatagaattacttat
aaggccattggtggaattgtggatttgtatttcttttctgggcctacgccggagttggtg
gtggagcagtatacagagctcattggtcgccctgcccctatgccctattggtcttttgga
ttccaccagtgtcgatatggttacaagaatgtttccgatcttgagggtgtggttgctggc
tatgcaaaagccgctatcccccttgaagttatgtggacagacattgattacatggatgca
tacaaggattttactcttgatcccatcaacttcccattggataagatgaagaaatttgtc
aacacccttcaccaaaatgatcagaaatatgtgctcatcttggaccctggtatcagtgtg
aataagagctatggaacctacaacagagggctgaaagcagatatatttataaaacgtgac
ggaattccttacctgggaagtgtttggcctggccctgtctatttccctgactttgcacat
ccacaaagtgaaaaattttgggctaatgagataaaaatatttcaagatgctctgcctttc
gatggtctttggcttgatatgaatgagctatccaatttcatcacgtcccctcccactcca
tcttctacacttgatgaccctccttacaagattaacaatgccggggtcctgcgtcccatc
aataacaatactgttccggcatcagcgctacacttcggtaacatcacagaatatggtgct
cataacttatatggactcttggaatccagagcaacaaacaaggccttagtcagtgtgact
ggtaaaagaccatttatactttctagatcaacttttgtaagctctggtacgtacacagca
cactggactggagacaattctgcagaatggagtgatctggcatacacaattccagcaatt
ctgaattttggcctcttcggagttccgatggttggagctgatatatgtggattctctgga
aatactactgaagagctctgcaggcggtggattcagctaggggccttttacccttttgca
agagatcactcagagaagtttacaatccgtcaagagctctatctttgggactcagtggct
gcaacggcaaggaaggtgcttggcctgcgctatcggttgctccccttgttttacacatca
atgtatgaggcacacaaaaaggggacccccattgcaagaccccttttcttctcatttcct
caagatatcagaacttatgagatcaacactcagtttctgattggcagaggtgtaatggtg
tcacctgtgttgaagccaggagtaagttcagttgatgcatattttcctgcaggaaactgg
tttgatctcttcaactactcaaactcagtaagtgtaaaatcgggagagcacgttacattg
gatgcaccacctgatcatatcaacgtacatgtccgtgaaggaaacattttggccttacaa
ggaaaggccttgacaacagaagcagcccgaaagactgcattcgaacttttggttgttagc
agcagcaatggacagagcactggagaagttttcttggatgatggagaggaagtggaaatg
ggaggaaagggaggcaagtggagtttagtgagattttactgtgcaacagaaaatggaagt
gtatctgtaagatcaacggttgtaaatggaggttttgctttaagccaaaaatggatcatt
gataaagttaccattattgggttggacaacgttgatggattggaagggtatgcgttgaac
attactaagggagcaaacttgaagggaggacactcagatatcagggccagctttggcatt
aataagcgattcgtcttggtagagatttccagattatccattcttataggagcagatttt
aacttggagctgaagtattga

DBGET integrated database retrieval system