KEGG   Prunus avium (sweet cherry): 110765083Help
Entry
110765083         CDS       T05161                                 

Definition
(RefSeq) glutamate decarboxylase 1-like
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
pavi  Prunus avium (sweet cherry)
Pathway
pavi00250  Alanine, aspartate and glutamate metabolism
pavi00410  beta-Alanine metabolism
pavi00430  Taurine and hypotaurine metabolism
pavi00650  Butanoate metabolism
pavi01100  Metabolic pathways
pavi01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pavi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    110765083
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    110765083
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    110765083
   00430 Taurine and hypotaurine metabolism
    110765083
Enzymes [BR:pavi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     110765083
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5
Motif
Other DBs
NCBI-GeneID: 110765083
NCBI-ProteinID: XP_021823826
LinkDB All DBs
Position
Unknown
AA seq 553 aa AA seqDB search
MCPTLPFPKLYTTTSFGDFVYIHLLPSSKPISAFLDLSLKLLHHHHQSITMVLSKTASES
DVSVHSTFASRYVRTSLPRFKMAENSIPKEAAYQIINDELMLDGNPRLNLASFVTTWMEP
ECDKLMMASINKNYVDMDEYPVTTELQNRCVNIIAHLFNAPLEESESAVGVGTVGSSEAI
MLAGLAFKRKWQNKRRAEGKPIDNPNIVTGANVQVCWEKFARYFEVELKEVKLKEGYYVM
DPEKAVEMVDENTICVAAILGSTLNGEFEDVKRVNDLLVEKNKETGWDTPIHVDAASGGF
IAPFLYPELEWDFRLPLVKSINVSGHKYGLVYAGIGWVIWRNKEDLPEELIFHINYLGAD
QPTFTLNFSKGSSQVIAQYYQLIRLGFEGYRNVMENCRENMIVLKEGLEKTKRFNIVSKD
EGVPLVAFSLRDNHRHDEFEISDLLRRFGWIVPAYTMPPDAQHVTVLRVVIREDFSRTLA
ERLVNDIQKVLHELDTLPSKLSSNVKAADGEDGKPAETRALESKKSDLEKTREITTIWRK
FVTARKQKMNVVC
NT seq 1662 nt NT seq  +upstreamnt  +downstreamnt
atgtgccccactcttcccttccctaagttgtatactactacttcatttggtgactttgtc
tacatccatcttcttccttcttcaaaacccatatccgcatttctagatctgtctctgaaa
ctactacaccatcatcatcaatccatcaccatggttctctcaaagactgcttcggagtcg
gatgtctccgtccactcaaccttcgcttctcgatatgttcgaacttctctccccagattc
aaaatggcggaaaactcgatccccaaggaggcagcgtaccagatcataaacgacgagctt
atgttggacggcaacccgaggttgaatctggcgtcgttcgtgaccacatggatggagcct
gagtgcgataaactgatgatggcctccatcaacaagaactacgtggacatggatgaatac
cctgtcaccactgagctccagaatcggtgcgtaaatatcatagctcatctattcaatgcc
ccattggaggagtcagagtcagcagttggagtgggaacggtgggctcttctgaggccatc
atgttggccggcttagctttcaagagaaagtggcagaacaagaggagagctgagggcaag
cccattgacaaccccaacattgtcaccggagccaatgtccaggtgtgctgggagaaattt
gcaaggtactttgaggtggagttgaaggaggtgaagttgaaggaaggatactatgtaatg
gaccctgagaaagcagtggagatggttgatgagaacaccatctgcgtcgctgctatcctc
ggctccactctcaatggagaattcgaagatgttaagcgcgtgaatgatctcttggtagag
aagaacaaggaaactggatgggatactccaatccatgtagacgcagcaagtggtgggttt
attgcaccatttttgtacccagaacttgagtgggacttccgtttgcccttagtgaagagc
atcaatgttagtggacacaagtacggacttgtgtatgcaggaattgggtgggtcatctgg
aggaacaaagaggacttgcctgaggaactcatcttccatatcaactatcttggagcagat
caacctaccttcaccctcaacttctctaaaggttccagccaagttattgctcaatattat
caactgattcgcttgggttttgagggatacaggaatgtcatggaaaattgtcgcgaaaac
atgatagtactaaaagaaggattggagaagacaaagcgcttcaacatagtctctaaagat
gaaggggtaccattggtggcattttctttgagggacaaccaccgccacgacgagttcgaa
atctctgacttgctccgccgctttggatggattgtccctgcctacaccatgcccccagat
gcgcaacatgtcacagttttgcgtgtcgtgattagagaagacttctctcgcactttggcg
gagcgcctagtgaatgatatccagaaagtgttgcatgaactagacacacttccatctaag
cttagctccaatgtgaaggctgccgacggagaggatgggaaacctgcagagacgagggca
ctagagagtaagaagagtgatttggaaaagacaagggagatcacaaccatttggaggaag
tttgttacggccaggaagcagaagatgaatgttgtttgttag

DBGET integrated database retrieval system