KEGG   Prunus avium (sweet cherry): 110765673Help
Entry
110765673         CDS       T05161                                 

Definition
(RefSeq) histone-lysine N-methyltransferase CLF
  KO
K11430  histone-lysine N-methyltransferase EZH2 [EC:2.1.1.43]
Organism
pavi  Prunus avium (sweet cherry)
Pathway
pavi00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:pavi00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    110765673
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:pavi03036]
    110765673
Enzymes [BR:pavi01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     110765673
Chromosome and associated proteins [BR:pavi03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     110765673
   Polycomb group proteins
    PRC2-EZH2 complex
     110765673
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: preSET_CXC SET TCR
Motif
Other DBs
NCBI-GeneID: 110765673
NCBI-ProteinID: XP_021824558
LinkDB All DBs
Position
Unknown
AA seq 916 aa AA seqDB search
MASKASPSASANRSEPHQEPPMTASQENMDVTRKEISLIIDSLKKQVVSNRGTSIKKRME
ENRQRLAGVTNNLYKLSMERGNNRFIDIGKSVDLLTKRQKDAFALQNGIDVSKDGSQEDG
HGSTAVLLESNVAVKSSVRPIKLPEVKRLPPYTTWIFLDRNQRMTEDQSVLGRRRIYYDQ
NGGEALICSDSEEEAVDEEDEKRDFVESEDYILSMAIKEVGFSDPVLESLAQCFSRSPSE
VKARYDTLVKEEEAVGGCKTMDNEDISQNGNYFLDKDLDAALDSFDNLFCRRCLVFDCRL
HGCSQDLVFPAEKQPPWSSPDAENASCGPNCYRSVLKSERIARVSSVDVEEKNVTSLDGA
SAQMSTRKKSSVISARKKVKSGQSESASSNAKAISESSDSENGPRQDATHHQTPSKTKLA
GKSGIGKRNSKRVAERVLVCMQKRQKKMVVSDSDSIVNAGLCPSDMKLRSNSCKDNEDTS
SSSQKNLKSSTSGGFRRKESPTKGRHKVVQVDVLDGSSDEIIADPPGTSSDDNLRKEECV
DENIYKQELSDDKTWKTIEKGLFDKGIEIFGRNSCLIARNLLNGMKNCWEVFQYMNYSES
KMSSQEGDAANSLVEGHSKGNNEARRRSRFLRRRGRVRRLKYTWKSAAYHSIRKRITERK
DQPCRQYNPCTCQTACGKQCSCLQNGTCCEKYCGCPKTCKNRFRGCHCAKSQCRSRQCPC
FAADRECDPDVCRNCWVSCGDGSLGVPNQRGDNYECRNMKLLLKQQQRVLLGRSDVSGWG
AFLKNSVGKHEYLGEYTGELISHREADKRGKIYDRENSSFLFNLNDQFVLDAYRKGDKLK
FANHAPDPNCYAKVIMVAGDHRVGIFAKERITAGEELFYDYRYEPDRAPAWARKPEASGS
KKDDGAPSSGRAKKLA
NT seq 2751 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcgaaggcttcgccttcagcttctgccaatagatcggagcctcaccaggaacct
ccgatgacggcatcacaagaaaacatggatgtaacccgtaaggagatttcattgatcata
gattccctaaagaagcaagttgtttctaaccggggtacttccattaagaaaagaatggag
gaaaacaggcagaggttggctggtgtcactaacaatttgtataaattgtcaatggaaaga
ggaaataataggtttattgatattggcaaaagtgtagatctattgacaaagaggcaaaaa
gatgcatttgccttgcaaaatggaattgatgtaagtaaggatggctctcaagaagatggc
catgggtccacagcagttcttctagaatctaatgttgcagtcaagagttctgttcgtcct
atcaagcttccggaagttaaaagactacctccttatactacatggatatttttggacaga
aaccaaaggatgacagaggatcagtcagtgttaggtcgaagaagaatttattatgatcaa
aatggaggtgaagctcttatatgtagtgatagtgaggaggaggcagttgatgaagaagat
gaaaagagggactttgttgaatcagaagactacatacttagcatggctataaaagaagtt
ggcttctctgatccagtgctggagtcattagcacagtgtttctctagaagtccttctgaa
gtcaaggcaagatatgatactctcgtaaaggaagaggaggctgtggggggttgtaaaact
atggataatgaagacatttcacaaaatgggaattattttcttgataaagatctagatgct
gctctggattcatttgacaacctattttgtcgtcgatgccttgtgtttgattgcagatta
catggatgttcacaggatcttgtctttcctgctgagaaacaacctccttggagctctcca
gatgccgaaaatgcatcatgtggtccaaattgctatcgatcagtactgaaatctgaaaga
attgctagagtgagctctgttgatgttgaagaaaaaaatgtcacatcattagatggtgct
agtgctcaaatgtcaacgagaaagaagtcttctgttatatctgctagaaagaaggtaaag
tccggccaaagtgaaagtgcttcatctaatgcaaaagccatctcagaaagcagtgattcg
gagaatggacccaggcaggatgctacccatcatcaaacaccctcaaagactaagctagca
ggaaaaagtggaattggcaagaggaacagcaagagagttgcagagcgtgttctagtttgc
atgcagaagaggcagaagaaaatggtggtttctgattctgattccattgttaatgctggt
ctttgtccaagtgatatgaagcttagatcaaattcatgcaaagataatgaagacactagt
tcttcttcacaaaagaatctgaaatcttctaccagtggagggtttaggaggaaggaatca
cctactaagggcagacacaaagtagttcaggttgatgttcttgatggttcatcagatgag
ataatcgctgatccacctggcactagtagtgatgacaatttgaggaaagaagagtgtgtg
gatgaaaacatctataaacaagaattaagtgatgataaaacatggaaaactattgaaaaa
ggccttttcgataaaggcatagagatttttggcaggaacagctgtttaatagcaaggaac
cttttaaatggtatgaaaaattgttgggaggtttttcagtatatgaattactcagagagt
aagatgtccagccaagaaggtgatgctgcaaattcccttgttgaaggacattccaagggt
aataatgaagcaagaagaagatcaagatttttacgtagaaggggtagagttcgtcgcttg
aagtatacttggaaatctgctgcttaccattcaatcaggaaacgaattactgagagaaaa
gatcagccttgcaggcagtataatccatgtacttgccaaacagcttgtggaaagcagtgt
tcttgtctacaaaatgggacttgttgcgagaagtactgtgggtgtcctaagacttgcaag
aatagatttaggggctgtcattgtgcgaaaagtcagtgccggagtcgtcagtgcccctgc
tttgctgcagacagggaatgtgatccagatgtttgtaggaattgctgggtcagttgcggt
gatgggtcccttggggttccaaaccaaagaggtgacaattatgagtgtagaaatatgaag
ctgcttctgaaacaacaacagagggtcttacttggaagatctgacgtatctggctggggt
gctttcttaaagaatagcgtcggcaagcatgaataccttggtgagtatactggggagttg
atctcacatcgggaagcagataagcgtggaaaaatatatgaccgtgaaaattcatcattt
ctcttcaatctgaacgatcagtttgtccttgatgcctatcgaaagggtgacaaattgaag
tttgccaaccatgctccagatccgaattgttatgcaaaggtcattatggttgctggagat
catagggtgggcatatttgccaaggaacggattactgcaggagaggaacttttctacgat
tatcgttatgagccggatagagctcctgcctgggctcggaagcctgaggcatcgggatcc
aagaaggatgacggtgctccttcaagtggtcgtgcaaagaagcttgcttaa

DBGET integrated database retrieval system