KEGG   Prunus avium (sweet cherry): 110767044Help
Entry
110767044         CDS       T05161                                 

Definition
(RefSeq) uncharacterized protein LOC110767044
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
pavi  Prunus avium (sweet cherry)
Pathway
pavi00061  Fatty acid biosynthesis
pavi00780  Biotin metabolism
pavi01100  Metabolic pathways
pavi01212  Fatty acid metabolism
Module
pavi_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:pavi00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    110767044
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    110767044
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:pavi01004]
    110767044
Enzymes [BR:pavi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     110767044
Lipid biosynthesis proteins [BR:pavi01004]
 Fatty acid synthase
  Component type
   110767044
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FabA MaoC_dehydratas 4HBT
Motif
Other DBs
NCBI-GeneID: 110767044
NCBI-ProteinID: XP_021826157
LinkDB All DBs
Position
Unknown
AA seq 234 aa AA seqDB search
MSTAASSTTLFSPAPSSQPPIFHKPTTALSLSRVSLGLGLPRSLPLSTTHLKTRRNSSRF
TTCCSTDAAKAPDKETPIELRYEAFPTVMDINQIREILPHRFPFLLVDRVIEYNPGVSAV
AIKNVTINDNFFPGHFPERPIMPGVLMVEAMAQVGGLVMLQPEVGGSRDTFFFAGIDKVR
FRKPVIAGDTLVMRMTLVKLQKRFGIAKMEGKAYVGGEVVCEGEFLMATGTGSD
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaccgcagcttcctccaccactctgttttctcctgctcccagttcgcagccaccg
atctttcataagccaacgactgctttatctctctcacgggtctctcttggccttgggctt
cctagatctctgcccctatcaacaactcatctgaaaactagaagaaattcaagtcgtttc
actacctgttgctccacagatgctgcaaaagctcccgacaaggagacccctattgaattg
agatatgaagcatttcctactgtcatggatatcaatcagattcgtgaaattttgcctcac
cggtttccatttctcttagtggatagagtgattgaatacaatcctggagtttctgctgtt
gcaatcaagaatgtaacaataaatgataatttctttcctgggcattttcctgagaggcca
atcatgcctggtgttctcatggttgaggcaatggcacaggtcggtggcttggttatgttg
caaccggaagtgggaggctctcgtgacactttcttttttgctggtattgacaaagtgcga
tttcggaaaccagtgattgctggcgacacattagtgatgagaatgacactagtcaagctg
cagaaacgctttggaatagcaaagatggaaggcaaggcctatgtgggaggtgaagtggtg
tgtgagggagagtttttgatggctactggtactggtagtgactga

DBGET integrated database retrieval system