KEGG   Prunus avium (sweet cherry): 110767151Help
Entry
110767151         CDS       T05161                                 

Definition
(RefSeq) spermine synthase
  KO
K00797  spermidine synthase [EC:2.5.1.16]
Organism
pavi  Prunus avium (sweet cherry)
Pathway
pavi00270  Cysteine and methionine metabolism
pavi00330  Arginine and proline metabolism
pavi00410  beta-Alanine metabolism
pavi00480  Glutathione metabolism
pavi01100  Metabolic pathways
Module
pavi_M00034  Methionine salvage pathway
Brite
KEGG Orthology (KO) [BR:pavi00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    110767151
   00330 Arginine and proline metabolism
    110767151
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    110767151
   00480 Glutathione metabolism
    110767151
Enzymes [BR:pavi01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.16  spermidine synthase
     110767151
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Spermine_synth Spermine_synt_N Methyltransf_25 Methyltransf_24 Methyltransf_30 Methyltransf_11 MTS Methyltransf_4 Methyltransf_31 Methyltransf_12
Motif
Other DBs
NCBI-GeneID: 110767151
NCBI-ProteinID: XP_021826297
LinkDB All DBs
Position
Unknown
AA seq 366 aa AA seqDB search
MEGGAGRGLECQKTMDGKASNGNGSEKAIPSCCLKARASAPEAEAKCHSTVVSGWFSESQ
SRSEKASKKVYFNNPMWPGEAHSLKVEKILYKGKSEFQEILVFESSTYGKVLVLDGIIQL
SEKDECAYQEMIAHLPLCSIPSPKTVLVVGGGDGGVLREVSRHPSVEHIDICEIDKMVVD
VSKKFFPQLAVGFQDPRVHLHIGDATEFLRHAPKGKYDAVIVDSSDPVGPAQELVEKPFF
ETIARALRPGGVLCNMAESMWLHTHLIQDMISVCRETFKGSVNYAWASVPTYPSGVIGFL
LCSTEGPPVDFKNPVNSIEKLEGALKHKRELRFYNSEMHSAAFALPPFLRREVSALCHSS
TSTLPR
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atggagggcggcgcaggaagaggtttggaatgccagaagactatggatgggaaggcgagt
aacgggaatggttcagagaaggccatcccttcttgttgcttgaaggctagggcttctgcc
cctgaggctgaggcgaaatgtcattctactgttgtttctgggtggttctcagaatcccag
tctcgctctgagaaggctagtaagaaggtttatttcaacaacccaatgtggcctggtgaa
gctcattcactgaaagtagaaaagattctgtacaagggaaaatcagagttccaagagatt
ttggtttttgagtcctcaacatatggaaaagtgcttgttcttgatggcattatccagctg
agtgagaaagatgaatgtgcataccaggagatgatagctcatctacctctttgttcaatt
ccttcccccaagacagttctggttgttggtggtggtgatggtggggttcttagggaggtt
tctcgccatccttctgttgagcatattgacatatgcgagatagataagatggttgtagat
gtttctaagaagtttttccctcagttagctgttggatttcaggaccctcgtgtccacctt
catattggtgatgctactgaattcctgaggcatgcacctaaagggaagtatgatgctgta
attgttgattcgtcagaccctgtaggtcctgctcaagagcttgtagagaaaccatttttt
gagacaatagctagggcattaaggcctggtggtgttctctgtaacatggcagagagtatg
tggctccatacgcatcttattcaagatatgatctctgtttgtcgtgaaacattcaaggga
tctgtcaattatgcatgggcgagtgttcctacgtatccaagtggtgtgataggctttctg
ttgtgctcaacggaggggcctcctgttgatttcaaaaatccagtcaattccattgagaag
ttagaaggagctctcaaacataagagagagcttaggttttataactccgagatgcactca
gctgcctttgccttgcctcctttcttgaggagggaggtgagcgctctatgccattcttca
acctcaaccctgccaagatga

DBGET integrated database retrieval system