KEGG   Prunus avium (sweet cherry): 110767411Help
Entry
110767411         CDS       T05161                                 

Definition
(RefSeq) hexokinase-2, chloroplastic
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
pavi  Prunus avium (sweet cherry)
Pathway
pavi00010  Glycolysis / Gluconeogenesis
pavi00051  Fructose and mannose metabolism
pavi00052  Galactose metabolism
pavi00500  Starch and sucrose metabolism
pavi00520  Amino sugar and nucleotide sugar metabolism
pavi01100  Metabolic pathways
pavi01110  Biosynthesis of secondary metabolites
pavi01200  Carbon metabolism
Module
pavi_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
pavi_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:pavi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    110767411
   00051 Fructose and mannose metabolism
    110767411
   00052 Galactose metabolism
    110767411
   00500 Starch and sucrose metabolism
    110767411
   00520 Amino sugar and nucleotide sugar metabolism
    110767411
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    110767411
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pavi04131]
    110767411
Enzymes [BR:pavi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     110767411
Membrane trafficking [BR:pavi04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    110767411
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-GeneID: 110767411
NCBI-ProteinID: XP_021826638
LinkDB All DBs
Position
Unknown
AA seq 494 aa AA seqDB search
MSVAATSPAVGSFYLRRRSPSTAMSMPRFRMAVRSAAVSVTPLLTKLHNDSATPLPLLRH
VADAMAADMRAGLAVEGGSDLKMILSYVDSLPSGNEEGLFYALDLGGTNFRVLRVQLGGK
QERVIATEFDQVSIPKELMFGTSEQLFDFIAAGLAKFAQKEGNKFHLPTGTKREIGFTFS
FPVKQTSIDSGILIKWTKGFSVSGTAGKDVVACLNEAMERQGLDMRVSALVNDTVGTLAG
ARYWDDDVMVAVILGTGTNACYVERADAIPKLQGQVSSSGKTIINTEWGAFSDGLPLTEF
DREMDAASINPGEQIFEKTISGMYLGEIVRRVLVKMAEADALFGESVPEKLSTPFVLRTP
DICAMQQDISDDLQDVGSILYNVAGVESNLSARKIVVDVCDTIVKRGGRLAGAGIVGILQ
KMEEDSKDLIFGKRTVVAMDGGLYENYPQYRRYLQEAVTELLGTEISKNVVIEHSKDGSG
IGAALLAAANSQYT
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgtcagttgctgccacgtccccagccgttggatctttctacctcaggcgccgatcacct
agtacggccatgtccatgcctcgctttaggatggccgtccgatctgctgccgtttctgtc
actccgctgttgaccaagctacacaacgactctgccactcctttgcccctcctgcgccac
gtggcagacgccatggccgccgacatgcgagccgggcttgccgtggaaggtgggagtgac
ctcaagatgatactcagctatgttgacagcctcccaagcgggaatgaggaggggttgttt
tatgcactggatcttggaggcacaaacttcagggtgctgagggtacaactaggcggcaaa
caagagcgcgtcattgccaccgaattcgaccaagtttccattcctaaagagcttatgttt
ggcacctcagagcaactgtttgatttcattgctgctgggctggcaaaatttgcacaaaaa
gagggtaataaattccaccttccaactggtacaaaaagggagattggattcacattttca
tttcctgtgaagcagacctccattgactctggcatactaattaagtggacaaagggtttt
tctgtttctggaacggcggggaaagatgtggttgcttgtttgaatgaggctatggaaagg
cagggacttgatatgcgggtgtctgccctggttaatgatacggttggaacattagctgga
gcaagatattgggatgatgatgtcatggttgctgttattttgggtactggaaccaatgct
tgctatgttgaacgggcagatgctatcccgaaactacagggtcaggtctcttcttctggc
aaaacgattattaacactgagtggggagcattctcagatggtcttcctttgactgaattt
gatagagaaatggatgctgctagtatcaatcccggtgagcagatctttgagaaaacaatt
tctggaatgtatctgggtgaaattgtacgaagagtgttagtgaagatggctgaagcagat
gctttgtttggtgaatctgtcccagaaaaactatcaacaccttttgtactcaggacccca
gatatatgtgctatgcagcaagatatatctgatgaccttcaagatgttggatcaatccta
tacaatgtagcaggggttgagtcaaatctaagtgcaagaaagattgtggtggatgtatgt
gacaccatcgtaaagcgaggtgggcgcttagctggtgcaggaatagtagggatacttcaa
aagatggaggaggattcaaaagatctcatctttggcaagaggacagtggtggcaatggat
ggagggttgtatgaaaactatcctcaatacagaagatatttgcaagaggctgtgacagag
cttcttgggacagagatttcgaagaatgtggtcatagaacattcgaaagatgggtctggc
ataggggctgctctcttggctgctgcaaattcccagtatacataa

DBGET integrated database retrieval system