KEGG   Prunus avium (sweet cherry): 110768574Help
Entry
110768574         CDS       T05161                                 

Definition
(RefSeq) glycine-rich cell wall structural protein 1.8-like
Organism
pavi  Prunus avium (sweet cherry)
SSDB OrthologParalogGFIT
Other DBs
NCBI-GeneID: 110768574
NCBI-ProteinID: XP_021828039
LinkDB All DBs
Position
Unknown
AA seq 827 aa AA seqDB search
MTTQNTHSFVFFMLLGIGICSAARTILHYKEPAHAPTVSYGAGYVVGGDGGSGYRVSGAT
SYGGVWGYGGVGGAGSGGGYGVIGEHGAPSYGGGSGGGKGGGVAYGGASGHGGGGGGSGA
ARHGSGSGEEGGASHGVGGEHGASGDGRGTGSGSGGGFGYAGKHGSGYRGGKGGGAGGSQ
GAGGKHDKGHGGGGGHGAGAGGGNGHGVGAEGGYVVGGAGGGASGGYVGGAGGGGEHGGG
AGGGSGHSVGGKHGAGAIEGGEQGGGAGGKHGASGKHGEGNGGGSGHGGAAGGGYVAGGA
SGGGARGEASGGYAGGVKGGGGDGDGAGGGGGHADGGKHGTGAIGSDEHNSSANGKHGAG
GEHGVGAIGGGKHGGGVGGKHGASGKHGKGHGGGGGHGGGAEGGDAHGVGGKHGASAIGS
NKHGGGTDGKHGVGGKHGAGAIGGGEHSGGAGGKHGASGKHGEGYGGGGHGGGVGGGYAV
GGASGGGAGGGASGGHAGGAGGGGGHGGGAGGGDAYGAGGKHSASAIGSDKHGGGADGKH
GAGAIGGGEHGAGADGKHGASGKHGEGYRGGGRHGGGAGGGYAAGGVSGGGAGGGASGGY
AGGAGGGGGHGGGARGGDGHGGADGKHGAGVIGGGEHGGGADGKQGAGGKHGKGYGGGGG
HGGGAGGGYAVGGASGGGVGGGASGGYAGGGGGFGGGNGYGGAYGGRGGGDGGGHGAGGK
HGASTIGEDKHGGGADGKHGAGGKHGAGAIGGGEHGGGAGGGGEHGGGAIGGYSAGGASG
GGVGGGTSGGYASGAGGGVFGGGSTYGGAYGAAYWRQGGGESGGYVP
NT seq 2484 nt NT seq  +upstreamnt  +downstreamnt
atgactactcaaaacactcatagttttgtcttctttatgttattaggtatagggatatgt
tctgcagccagaacaatcctacactataaagagcctgcccatgctcctactgtcagctat
ggtgcaggctatgtcgtcggtggtgatggtggatcggggtatagagttagtggtgctaca
agttatggtggtgtttggggatatggtggcgtaggaggtgcaggaagtggtgggggttat
ggagtgataggagaacatggcgctcctagctatggaggtggtagtggtggtggaaaaggc
ggtggcgttgcctatggaggtgctagtggacatggtggcggtggcggtggtagtggtgct
gcaagacatggaagtgggagtggtgaagaaggtggtgccagtcatggtgttggtggtgaa
catggagcgagcggcgatggtcgaggtactggcagtggcagtggcggtggctttggatat
gctggaaagcatggcagtggttacagaggtggaaaaggtggtggtgccggtggcagtcag
ggtgctggtggcaaacatgataaaggccatggaggaggaggcggacatggtgctggtgcc
ggaggaggcaacggacatggtgttggtgccgaaggaggttatgttgttggaggagctgga
ggtggagctagtggtggctatgtaggtggtgcaggaggaggtggcgaacatggtggtggt
gctggaggaggcagcggacatagtgttggtggcaaacatggtgctggtgccattgaaggc
ggcgaacaaggtggtggtgccggtggcaaacatggtgctagtggaaaacatggcgaaggc
aatggaggaggcagtggacatggtggtgctgccggaggaggttatgttgctggaggagca
agtggtggaggagctagaggtgaagctagtggtggctatgcaggtggtgtaaaaggaggc
ggcggagatggtgatggtgccggaggaggcggcggacatgctgatggtggcaaacatggt
actggtgccattggaagcgatgaacataatagtagtgccaatggcaaacatggtgctggt
ggcgaacatggtgttggtgccattggaggcggcaaacatggtggtggtgtcggtggtaaa
catggtgctagtggaaaacatggcaaaggccatggaggaggcggcggacatggtggtggt
gccgaaggaggcgacgcacatggtgttggtggcaaacatggtgctagtgccattggaagc
aacaaacatggtggtggtactgatggcaaacatggtgttggtggcaaacatggtgctggt
gccattggaggcggcgaacatagtggtggtgccggtggcaaacatggtgctagtggaaaa
catggcgagggctatggaggaggtggacatggtggtggtgtcggaggaggttatgctgtt
ggaggagcaagtggtggaggagctggaggtggagctagtggtggccatgcaggcggtgca
ggaggaggcggcggacatggtggtggtgccggaggaggtgacgcatatggtgctggtggc
aaacatagtgctagtgccattggaagcgacaaacatggtggtggtgccgatggcaaacat
ggtgctggtgccattggaggtggcgaacatggtgctggtgccgatggcaaacatggtgct
agtggaaaacatggcgaaggctatagaggaggcggcagacatggtggtggtgccggagga
ggttatgctgctggaggagtaagtggtggaggagctggaggtggagctagtggtggctat
gcaggtggtgcaggaggaggcggcggacatggtggtggtgctagaggaggtgacggacat
ggtggtgccgatggcaaacatggtgctggtgtcattggaggcggtgaacatggtggtggt
gccgatggcaaacaaggtgctggtggaaaacatggcaaaggctatggaggaggcggcgga
catggtggtggtgccggaggaggttatgctgttggaggagcaagtggtggaggagttgga
ggtggagccagtggaggctatgcaggtggaggaggaggtttcggtggtggcaacggctat
ggaggtgcatatggaggacgaggtggtggtgatggtggtggccatggtgctggtggcaaa
catggtgctagtaccattggagaagacaaacatggtggtggtgccgatggcaaacatggt
gctggtggcaaacatggtgctggtgccattggaggtggcgaacatggtggtggtgccgga
ggaggcggcgaacatggtggtggtgccattggaggttattctgctggaggagcaagtggt
ggtggggttggcggtggaactagtggtggctatgcaagtggtgcaggcggaggagttttc
ggtggtggcagcacctatggaggagcttatggagctgcatattggagacaaggtggtggt
gagagcggtggttatgttccttga

DBGET integrated database retrieval system