KEGG   Prunus avium (sweet cherry): 110770952Help
Entry
110770952         CDS       T05161                                 

Definition
(RefSeq) enoyl-[acyl-carrier-protein] reductase [NADH], chloroplastic
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
pavi  Prunus avium (sweet cherry)
Pathway
pavi00061  Fatty acid biosynthesis
pavi00780  Biotin metabolism
pavi01100  Metabolic pathways
pavi01212  Fatty acid metabolism
Module
pavi_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:pavi00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    110770952
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    110770952
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    110770952
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:pavi01004]
    110770952
Enzymes [BR:pavi01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     110770952
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     110770952
Lipid biosynthesis proteins [BR:pavi01004]
 Fatty acid synthase
  Component type
   110770952
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short_C2 adh_short Enoyl_reductase
Motif
Other DBs
NCBI-GeneID: 110770952
NCBI-ProteinID: XP_021830874
LinkDB All DBs
Position
Unknown
AA seq 392 aa AA seqDB search
MATTAASSLQMATSRPCISSSRRAFVSSAAMLNGNFKLASWTKLSSACHIASAQPFHRSF
TSSSLKMDKFVTKAMAGASENKPASGLPIDLKGKRAFIAGVADDNGYGWAIAKSLAAAGA
EILVGTWVPALNIFESSLRRGKFDESRVLPDGSLMEITKIYPLDAVFDNPEDVPDDIKTN
KRYAGSSKWTVQEAAESVKSDFGSIDILVHSLANGPEVVKPLLETSRKGYLAALSASSYS
YVSLLKHFLPIINPGGSSISLTYIASERIIPGYGGGMSSAKAALESDTRVLAFEAGRRKG
IRVNTISAGPLRSRAAKAIGFIDMMIDYSSANAPLQKELSAEEVGNTAAFLASPLASAIT
GGVIYVDNGLNAMGVGVDSPIFEKLDIPKAQH
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atggcaacaactgctgcttccagcctgcaaatggcaacttccagaccctgcatttcctct
tctcgtagagcttttgtgtcaagtgctgcaatgcttaatggtaattttaagctggcttca
tggactaagctttcgagtgcatgccatatagcatctgcacaacctttccaccggagcttt
acatcatcatctctaaaaatggataagtttgttacaaaggcgatggctggagctagtgaa
aacaagcctgcctcagggttgccaattgatttgaaaggtaagagggcatttatcgctggt
gtagctgatgataatggatatggttgggcaattgcaaaatctctagctgctgcaggtgct
gaaattcttgtgggcacatgggtgcctgctctgaacatttttgagtccagcctgcgacgt
ggaaagtttgatgagtcacgcgtgttaccagatggttctttaatggagattaccaagata
tatcccctagatgctgtttttgacaaccctgaggatgttcctgatgatataaaaacaaat
aagcgctatgcaggatccagtaaatggactgtccaggaagctgctgaatctgtcaagagt
gattttggcagcattgacattcttgtgcactcacttgcaaatggaccagaggtagttaaa
cctctgctggagacatccagaaagggatatctcgctgctctatcagcatcgagttattcc
tatgtttctctactcaagcatttcctcccaataattaatccaggtggttcatcaatttct
cttacctatattgcttccgagaggatcattcctggatatggtggaggtatgagctctgca
aaagctgctctcgagagtgacactcgagttcttgcttttgaagctgggagaagaaaggga
attagagtcaacacaatatctgctggtccactgagaagccgtgctgcaaaagcaatagga
tttattgatatgatgattgactattcatcagccaatgcacctctacaaaaagaactgtct
gcagaggaggtagggaacactgctgcgttcttggcatcacctttggcctctgccattact
ggcggtgttatatatgtggacaatggtttgaatgcaatgggtgtgggagttgacagtcca
attttcgagaaactcgatattccaaaggctcagcactga

DBGET integrated database retrieval system