KEGG   Prunus avium (sweet cherry): 110773605Help
Entry
110773605         CDS       T05161                                 

Definition
(RefSeq) succinate dehydrogenase [ubiquinone] flavoprotein subunit 1, mitochondrial
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
pavi  Prunus avium (sweet cherry)
Pathway
pavi00020  Citrate cycle (TCA cycle)
pavi00190  Oxidative phosphorylation
pavi01100  Metabolic pathways
pavi01110  Biosynthesis of secondary metabolites
pavi01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pavi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    110773605
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    110773605
Enzymes [BR:pavi01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     110773605
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 GIDA FAD_binding_3 Thi4 DAO HI0933_like
Motif
Other DBs
NCBI-GeneID: 110773605
NCBI-ProteinID: XP_021833829
LinkDB All DBs
Position
Unknown
AA seq 633 aa AA seqDB search
MWRCVSRRLGVPSSQRSVSSDSLRSHFSRLFSTESATGCSPYTVVDHTYDAVVVGAGGAG
LRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWL
GDQDAIQYMCREAPKAVIELENYGLPFSRTEDGRIYQRAFGGQSLDFGKGGQAYRCACAA
DRTGHALLHTLYGQAMKHNTQFFVEYFALDLLMNSDGSCQGVIALNMEDGTLHRFQAAST
ILATGGYGRAYFSATSAHTCTGDGNAMVARAGLPLQDLEFVQFHPTGIYGAGCLITEGSR
GEGGILRNSEGERFMERYAPTAKDLASRDVVSRSMTMEIREGRGVGPLKDHIYLHLNHLP
PDVLKERLPGISETAAIFAGVDVTKEPIPVLPTVHYNMGGIPTNYHGEVVTKKGNDPDVI
IPGLMAAGEAACASVHGANRLGANSLLDIVVFGRACANRVAEIHKPGEKQQPLEKDSGEQ
TIAWLDKIRNSNGSLPTSQIRLNMQRIMQNNAAVFRTQETLEEGSQLIDKAWESFDDVQV
KDRSLIWNSDLIETIELENLLINACVTMHSAEARKESRGAHAREDFTKRDDEKWMKHTLG
YWENEKVRLDYRPVHLNTLDDEIESFPPKARVY
NT seq 1902 nt NT seq  +upstreamnt  +downstreamnt
atgtggcggtgcgtttctcgtcgacttggcgttccttcttcccagagatccgtctccagt
gactctcttagatctcacttctccaggctcttctccactgaatccgctacagggtgctct
ccgtacactgtcgtggaccacacttatgatgccgtggttgtcggggctggtggtgcaggg
ctgagagcagccataggactttcagagcatggatttaataccgcttgcattacgaagctt
ttcccaactcgttcacatactgttgcagcccagggtggcataaatgctgcattagggaat
atgacagaggatgactggagatggcacatgtatgacacagtcaagggaagcgattggctg
ggtgatcaagatgccatccagtatatgtgtagagaggctccaaaagctgtgattgaactt
gaaaattatggattgccattttctcgaactgaagatggaagaatatatcagcgtgcattt
ggtgggcagagccttgacttcggaaaaggtggacaggcataccgctgtgcttgtgctgct
gacagaactgggcatgctctattacatactctctatggacaagctatgaagcataataca
caattttttgtcgaatatttcgctttggatcttctaatgaacagtgatgggagctgccaa
ggagttattgcattaaatatggaggacgggactttgcatcggttccaagcagcatcaaca
attttggccacagggggttatggtagagcatatttctctgcaacctcagctcatacctgc
actggagatggtaatgccatggtcgcacgtgctggacttcctcttcaggatttggagttt
gtgcagtttcaccctactggtatatatggtgctgggtgcctcataactgaaggatcacga
ggggaaggtggtatcctaaggaatagtgaaggtgagcgatttatggaacgatatgcccct
acagcgaaagaccttgcttctagggatgttgtgtcaagatctatgactatggaaatccgg
gagggtcgtggtgtaggacctttgaaggaccacatctatctccacttgaatcatttgccc
ccagatgtactcaaggagaggcttcctggtatctctgaaactgctgccatttttgctggc
gtggatgttacaaaagagcctattcccgtcttacctactgtgcactataatatgggtgga
attccgaccaattatcatggagaggtcgttaccaaaaaaggtaatgatccagatgttata
attcctgggttaatggcagctggggaggcagcctgtgcatctgtgcatggtgccaatcgg
cttggtgcaaattcactccttgacattgttgtttttggccgagcttgtgcaaatagagtt
gcagagatccataaaccaggggagaaacaacagcctctggaaaaggattctggtgagcag
accattgcatggttggacaaaataaggaattcaaatggttcactaccaacttcgcaaatc
cggttgaatatgcaacgaataatgcaaaataatgctgctgtgttccgcacacaagaaaca
ttagaagaaggttctcagttgattgacaaggcatgggagagttttgatgatgttcaagtg
aaggatcggagtttgatatggaactctgacttgatagagactatagagttggaaaacctt
ttgataaatgcctgtgtcaccatgcattctgctgaagccaggaaagagagcagaggagca
catgctcgtgaagacttcacgaaaagggatgatgagaagtggatgaaacatactctagga
tactgggaaaatgagaaggtccgactagactacagaccagttcacttgaacacattagac
gatgaaattgagtcattcccacctaaagctcgtgtctactga

DBGET integrated database retrieval system