KEGG   Prunus avium (sweet cherry): 110773684Help
Entry
110773684         CDS       T05161                                 

Definition
(RefSeq) glycerol-3-phosphate dehydrogenase SDP6, mitochondrial
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
pavi  Prunus avium (sweet cherry)
Pathway
pavi00564  Glycerophospholipid metabolism
pavi01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pavi00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    110773684
Enzymes [BR:pavi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     110773684
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAO DAO_C FAD_oxidored FAD_binding_2 NAD_binding_8 Pyr_redox_2 Pyr_redox
Motif
Other DBs
NCBI-GeneID: 110773684
NCBI-ProteinID: XP_021833896
LinkDB All DBs
Position
Unknown
AA seq 629 aa AA seqDB search
MATAIRLRRLGAAAAVATAASGAFLIQPSYSDSDRGSGPASIAAVRQRISDRNAVVPSRA
AQECALIAATDENPLDILVVGGGATGSGVAFDAVTRGLRVGLVEREDFSSGTSSRSTKLI
HGGVRYLEKAVFNLDYGQLKLVFHALEERKQVIENAPHLCHALPCMTPCFDWFEVVYYWM
GLKMYDLVAGLRLLHVSRYYSAQESVELFPTLARKGNNKSLKGTVVYYDGQMNDARLNVG
LACSAAVAGAAVLNHAEVVSFLKDEASNRTIGARIRDNLSGKEFDTYAKVVVNAAGPFCD
SVRKLADKDVKPMICPSSGVHIVLPDYYSPEGMGLIVPKTKDGRVVFMLPWLGRTIAGTT
DSNTPITLLPEPHEDEIQFILDAICDYLNVKVRRTDVLSAWSGIRPLATDPSAKNTESIS
RDHVVCEDYPGLVTITGGKWTTYRGMAEDAVNAAIKSGRLTPQNGCLTSKLQIVGGDGWD
PASFTVIAQQYTRMKKSHGKVVPGVMDTAAAKHLSHAYGTWAERVAAIAQNENLGKRLAH
GYPILEAEVAYCARNEYCESAIDFIARRSRLAFLDTDAASRALPRVIEILASEHSWDDSR
QKYELQKAKEFLETFKSSRNAQFHDGKHV
NT seq 1890 nt NT seq  +upstreamnt  +downstreamnt
atggccaccgccatacgcctgcgccggctcggagccgccgccgctgtcgcaaccgcagct
agcggcgcgttcctcatccaaccgtcgtactccgacagcgatcgcggcagtgggcctgca
tccatcgcagctgttcgccagaggatcagcgaccgcaacgccgtcgttccgtccagggcg
gcccaggagtgtgctctgatcgctgccaccgacgagaacccgctcgacattctcgtggtc
ggcggtggcgccaccggcagtggagtcgcttttgacgctgtcacccgaggcctccgcgtt
ggtctcgttgagcgcgaggacttctcatctggcacgtcgtcgcggtccacgaagctaatt
cacggaggtgttcggtacttggagaaagctgtttttaatcttgactacgggcagctgaag
ctggtattccatgcgcttgaggagcgtaaacaggttattgagaatgcaccacacctctgt
catgctttgccatgcatgacaccatgttttgactggtttgaggtagtatactactggatg
ggcttgaaaatgtacgatttggtcgcaggactacgcctgttacatgtgtctagatattat
tcggcacaagaatctgttgagctcttccccactcttgcaaggaagggtaacaataaaagc
ttgaagggcactgtggtgtattatgatgggcagatgaatgacgcacgtcttaatgttgga
ttggcgtgctctgctgcagtagctggtgcagcagtgcttaaccatgcagaagtggtttcg
tttttgaaggatgaggctagcaatcggacaattggtgcaagaatccgagacaatttatca
ggaaaagagtttgatacatatgcaaaagttgttgtgaatgctgctgggccattttgtgat
tctgtaaggaagctggcagacaaagatgtaaagcctatgatatgtccaagcagtggtgta
catatcgtacttcctgattattattctcctgaaggtatgggtttgattgttcctaaaact
aaggatggacgtgttgttttcatgctaccgtggttgggacgaacaattgctggcaccaca
gattccaacacccctattactctgcttcctgaaccacatgaggatgagattcaattcata
ctggatgccatttgtgattacctgaatgtcaaggtacgacgcacagacgttctctccgca
tggagtggtattcgccctttggcaacagatccatctgcaaaaaacaccgagagcatctcc
agagatcatgttgtatgtgaagattatcctggtttggtaacaatcacaggtggcaagtgg
accacttaccgtggcatggcagaagatgcggttaatgcagcaataaagtctggaaggctc
accccacaaaatggatgtttgacctcgaagctgcagattgtcggtggagatggatgggac
cctgcatcttttacagttattgctcaacaatatacacgcatgaagaagagtcatggtaaa
gttgttcctggagtgatggacactgctgcagcaaagcatctgtcccatgcatatggtact
tgggctgaacgagttgctgccattgctcagaatgaaaatctggggaagaggcttgcccat
ggatacccaattctagaggctgaggttgcttactgtgctcgaaatgagtactgtgaatct
gccattgatttcattgctcggagatctcggcttgctttccttgatactgatgcagcaagc
agggcattgcctcgtgtaattgaaatattagcttctgaacacagctgggatgattcgagg
cagaagtacgagttacagaaggccaaagaatttttggaaaccttcaaatcttcaagaaat
gctcagttccatgatgggaaacatgtttag

DBGET integrated database retrieval system